SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238896485|ref|YP_002921223.1| from Klebsiella pneumoniae NTUH-K2044

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238896485|ref|YP_002921223.1|
Domain Number 1 Region: 1-195
Classification Level Classification E-value
Superfamily ITPase-like 1.31e-74
Family ITPase (Ham1) 0.0000000175
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238896485|ref|YP_002921223.1|
Sequence length 197
Comment putative deoxyribonucleotide triphosphate pyrophosphatase [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
Sequence
MQKVVLATGNAGKVRELASLLEDFGLDIVAQTELGVDSAEETGLTFIENAILKARHAAQI
TGLPAIADDSGLAVDALGGAPGIYSARYSGVDASDQQNLEKLLDALKDVPDDQRQAQFHC
VLVYLRHAEDPTPLVCHGSWPGVITRQAAGHGGFGYDPIFFVPSEGKTAAELSREEKSAI
SHRGQALKLLLEALRNG
Download sequence
Identical sequences A0A0E1C9D6 A0A0H3GYB8 A0A0J2GKJ4 A0A1D3KM77 A0A1Y0PWD9 A0A2G8AIM8 A6TDW4 V0B6A2 W1AT07 W1DRP9 W1EFK9 W1HW79 W8UF60 W9BN38
WP_002916615.1.100062 WP_002916615.1.100145 WP_002916615.1.100175 WP_002916615.1.100176 WP_002916615.1.100239 WP_002916615.1.100268 WP_002916615.1.100385 WP_002916615.1.100403 WP_002916615.1.100410 WP_002916615.1.100465 WP_002916615.1.100566 WP_002916615.1.100599 WP_002916615.1.10061 WP_002916615.1.100611 WP_002916615.1.100635 WP_002916615.1.100698 WP_002916615.1.100702 WP_002916615.1.100713 WP_002916615.1.100896 WP_002916615.1.100964 WP_002916615.1.100988 WP_002916615.1.10102 WP_002916615.1.101198 WP_002916615.1.101234 WP_002916615.1.101332 WP_002916615.1.10134 WP_002916615.1.101391 WP_002916615.1.101451 WP_002916615.1.101480 WP_002916615.1.101526 WP_002916615.1.101528 WP_002916615.1.101549 WP_002916615.1.101648 WP_002916615.1.101702 WP_002916615.1.101749 WP_002916615.1.101834 WP_002916615.1.101867 WP_002916615.1.101892 WP_002916615.1.10194 WP_002916615.1.10203 WP_002916615.1.102072 WP_002916615.1.10213 WP_002916615.1.102146 WP_002916615.1.10218 WP_002916615.1.10241 WP_002916615.1.10296 WP_002916615.1.10360 WP_002916615.1.10395 WP_002916615.1.10456 WP_002916615.1.10473 WP_002916615.1.10604 WP_002916615.1.1061 WP_002916615.1.10681 WP_002916615.1.10778 WP_002916615.1.10889 WP_002916615.1.11020 WP_002916615.1.11036 WP_002916615.1.11122 WP_002916615.1.11147 WP_002916615.1.11191 WP_002916615.1.11210 WP_002916615.1.11237 WP_002916615.1.11267 WP_002916615.1.11269 WP_002916615.1.11340 WP_002916615.1.11506 WP_002916615.1.11535 WP_002916615.1.11551 WP_002916615.1.11555 WP_002916615.1.11601 WP_002916615.1.11647 WP_002916615.1.11683 WP_002916615.1.11685 WP_002916615.1.11694 WP_002916615.1.11733 WP_002916615.1.11742 WP_002916615.1.11783 WP_002916615.1.11791 WP_002916615.1.11808 WP_002916615.1.11827 WP_002916615.1.11864 WP_002916615.1.11891 WP_002916615.1.1193 WP_002916615.1.11957 WP_002916615.1.11994 WP_002916615.1.12006 WP_002916615.1.12032 WP_002916615.1.12074 WP_002916615.1.12082 WP_002916615.1.12086 WP_002916615.1.12089 WP_002916615.1.12237 WP_002916615.1.1226 WP_002916615.1.12281 WP_002916615.1.12418 WP_002916615.1.12445 WP_002916615.1.1245 WP_002916615.1.12462 WP_002916615.1.12481 WP_002916615.1.12564 WP_002916615.1.12602 WP_002916615.1.12689 WP_002916615.1.12722 WP_002916615.1.12747 WP_002916615.1.12900 WP_002916615.1.12924 WP_002916615.1.12939 WP_002916615.1.1298 WP_002916615.1.12983 WP_002916615.1.13030 WP_002916615.1.13044 WP_002916615.1.13149 WP_002916615.1.13174 WP_002916615.1.13202 WP_002916615.1.1322 WP_002916615.1.13373 WP_002916615.1.13386 WP_002916615.1.13450 WP_002916615.1.13483 WP_002916615.1.13541 WP_002916615.1.13594 WP_002916615.1.13646 WP_002916615.1.13660 WP_002916615.1.13773 WP_002916615.1.13922 WP_002916615.1.14068 WP_002916615.1.14109 WP_002916615.1.14118 WP_002916615.1.14138 WP_002916615.1.14171 WP_002916615.1.14234 WP_002916615.1.14248 WP_002916615.1.14268 WP_002916615.1.14290 WP_002916615.1.14407 WP_002916615.1.14580 WP_002916615.1.14585 WP_002916615.1.14594 WP_002916615.1.14603 WP_002916615.1.1464 WP_002916615.1.14715 WP_002916615.1.14732 WP_002916615.1.14735 WP_002916615.1.1478 WP_002916615.1.14796 WP_002916615.1.14830 WP_002916615.1.14851 WP_002916615.1.14920 WP_002916615.1.14986 WP_002916615.1.14996 WP_002916615.1.15060 WP_002916615.1.15063 WP_002916615.1.15082 WP_002916615.1.1513 WP_002916615.1.15194 WP_002916615.1.15243 WP_002916615.1.15279 WP_002916615.1.15307 WP_002916615.1.1532 WP_002916615.1.15320 WP_002916615.1.15331 WP_002916615.1.15361 WP_002916615.1.15574 WP_002916615.1.15610 WP_002916615.1.15629 WP_002916615.1.1572 WP_002916615.1.15832 WP_002916615.1.15839 WP_002916615.1.15852 WP_002916615.1.160 WP_002916615.1.16128 WP_002916615.1.16196 WP_002916615.1.16289 WP_002916615.1.16299 WP_002916615.1.1631 WP_002916615.1.16314 WP_002916615.1.16326 WP_002916615.1.16348 WP_002916615.1.16380 WP_002916615.1.16505 WP_002916615.1.16515 WP_002916615.1.16542 WP_002916615.1.16559 WP_002916615.1.16659 WP_002916615.1.16738 WP_002916615.1.16758 WP_002916615.1.16830 WP_002916615.1.16877 WP_002916615.1.16917 WP_002916615.1.16928 WP_002916615.1.17053 WP_002916615.1.17236 WP_002916615.1.17326 WP_002916615.1.17342 WP_002916615.1.17556 WP_002916615.1.17587 WP_002916615.1.17661 WP_002916615.1.17736 WP_002916615.1.1782 WP_002916615.1.17926 WP_002916615.1.17930 WP_002916615.1.18148 WP_002916615.1.18150 WP_002916615.1.18171 WP_002916615.1.18176 WP_002916615.1.18217 WP_002916615.1.18227 WP_002916615.1.18241 WP_002916615.1.18284 WP_002916615.1.18296 WP_002916615.1.18351 WP_002916615.1.18378 WP_002916615.1.18409 WP_002916615.1.18431 WP_002916615.1.18434 WP_002916615.1.18443 WP_002916615.1.18664 WP_002916615.1.1869 WP_002916615.1.187 WP_002916615.1.18716 WP_002916615.1.18736 WP_002916615.1.18788 WP_002916615.1.18832 WP_002916615.1.18932 WP_002916615.1.18964 WP_002916615.1.19278 WP_002916615.1.19354 WP_002916615.1.1937 WP_002916615.1.19421 WP_002916615.1.19439 WP_002916615.1.19476 WP_002916615.1.19533 WP_002916615.1.19664 WP_002916615.1.1986 WP_002916615.1.19888 WP_002916615.1.19911 WP_002916615.1.19984 WP_002916615.1.19989 WP_002916615.1.2000 WP_002916615.1.20019 WP_002916615.1.20050 WP_002916615.1.20122 WP_002916615.1.20179 WP_002916615.1.20205 WP_002916615.1.20217 WP_002916615.1.2023 WP_002916615.1.2031 WP_002916615.1.20375 WP_002916615.1.20426 WP_002916615.1.2045 WP_002916615.1.20472 WP_002916615.1.20476 WP_002916615.1.205 WP_002916615.1.20528 WP_002916615.1.20621 WP_002916615.1.20639 WP_002916615.1.20647 WP_002916615.1.2068 WP_002916615.1.20685 WP_002916615.1.20750 WP_002916615.1.20811 WP_002916615.1.20823 WP_002916615.1.20902 WP_002916615.1.21023 WP_002916615.1.21088 WP_002916615.1.21228 WP_002916615.1.21323 WP_002916615.1.21566 WP_002916615.1.21587 WP_002916615.1.21772 WP_002916615.1.21791 WP_002916615.1.21799 WP_002916615.1.21813 WP_002916615.1.21831 WP_002916615.1.21851 WP_002916615.1.21854 WP_002916615.1.21913 WP_002916615.1.2193 WP_002916615.1.21953 WP_002916615.1.22101 WP_002916615.1.22129 WP_002916615.1.22191 WP_002916615.1.22215 WP_002916615.1.22398 WP_002916615.1.2243 WP_002916615.1.22447 WP_002916615.1.22471 WP_002916615.1.2252 WP_002916615.1.22534 WP_002916615.1.2258 WP_002916615.1.22584 WP_002916615.1.22607 WP_002916615.1.22630 WP_002916615.1.22648 WP_002916615.1.2265 WP_002916615.1.22686 WP_002916615.1.22698 WP_002916615.1.22712 WP_002916615.1.2272 WP_002916615.1.22836 WP_002916615.1.22929 WP_002916615.1.22956 WP_002916615.1.23071 WP_002916615.1.23085 WP_002916615.1.23112 WP_002916615.1.23144 WP_002916615.1.23145 WP_002916615.1.23437 WP_002916615.1.23454 WP_002916615.1.2346 WP_002916615.1.2350 WP_002916615.1.23543 WP_002916615.1.23560 WP_002916615.1.23562 WP_002916615.1.23564 WP_002916615.1.23609 WP_002916615.1.23614 WP_002916615.1.2367 WP_002916615.1.23672 WP_002916615.1.23673 WP_002916615.1.23758 WP_002916615.1.23868 WP_002916615.1.23877 WP_002916615.1.23921 WP_002916615.1.23982 WP_002916615.1.24027 WP_002916615.1.24036 WP_002916615.1.24055 WP_002916615.1.24074 WP_002916615.1.24095 WP_002916615.1.24103 WP_002916615.1.2414 WP_002916615.1.24166 WP_002916615.1.24209 WP_002916615.1.24211 WP_002916615.1.24267 WP_002916615.1.2432 WP_002916615.1.24342 WP_002916615.1.24353 WP_002916615.1.2447 WP_002916615.1.24566 WP_002916615.1.24587 WP_002916615.1.24590 WP_002916615.1.24635 WP_002916615.1.24707 WP_002916615.1.24801 WP_002916615.1.24816 WP_002916615.1.24822 WP_002916615.1.24890 WP_002916615.1.24911 WP_002916615.1.24919 WP_002916615.1.24951 WP_002916615.1.25122 WP_002916615.1.2513 WP_002916615.1.25163 WP_002916615.1.25198 WP_002916615.1.25239 WP_002916615.1.25254 WP_002916615.1.25306 WP_002916615.1.25318 WP_002916615.1.2536 WP_002916615.1.25379 WP_002916615.1.25391 WP_002916615.1.25407 WP_002916615.1.25492 WP_002916615.1.25559 WP_002916615.1.25563 WP_002916615.1.25575 WP_002916615.1.25904 WP_002916615.1.25918 WP_002916615.1.25920 WP_002916615.1.25933 WP_002916615.1.25938 WP_002916615.1.25942 WP_002916615.1.25969 WP_002916615.1.25987 WP_002916615.1.26045 WP_002916615.1.26067 WP_002916615.1.26200 WP_002916615.1.26219 WP_002916615.1.26299 WP_002916615.1.26308 WP_002916615.1.26336 WP_002916615.1.26342 WP_002916615.1.26396 WP_002916615.1.26427 WP_002916615.1.26448 WP_002916615.1.26475 WP_002916615.1.26545 WP_002916615.1.26639 WP_002916615.1.2683 WP_002916615.1.26830 WP_002916615.1.26843 WP_002916615.1.2686 WP_002916615.1.26890 WP_002916615.1.27037 WP_002916615.1.27054 WP_002916615.1.27121 WP_002916615.1.27144 WP_002916615.1.2716 WP_002916615.1.27224 WP_002916615.1.27264 WP_002916615.1.27268 WP_002916615.1.27319 WP_002916615.1.27356 WP_002916615.1.27443 WP_002916615.1.27477 WP_002916615.1.27488 WP_002916615.1.27543 WP_002916615.1.27703 WP_002916615.1.27722 WP_002916615.1.27809 WP_002916615.1.27828 WP_002916615.1.27952 WP_002916615.1.2796 WP_002916615.1.28049 WP_002916615.1.28112 WP_002916615.1.28115 WP_002916615.1.28135 WP_002916615.1.2814 WP_002916615.1.28152 WP_002916615.1.28196 WP_002916615.1.28203 WP_002916615.1.28291 WP_002916615.1.28375 WP_002916615.1.28435 WP_002916615.1.28463 WP_002916615.1.28640 WP_002916615.1.28688 WP_002916615.1.2870 WP_002916615.1.28717 WP_002916615.1.28752 WP_002916615.1.28764 WP_002916615.1.28910 WP_002916615.1.28927 WP_002916615.1.28972 WP_002916615.1.28974 WP_002916615.1.29021 WP_002916615.1.29072 WP_002916615.1.29120 WP_002916615.1.29240 WP_002916615.1.29333 WP_002916615.1.29334 WP_002916615.1.29346 WP_002916615.1.29392 WP_002916615.1.29466 WP_002916615.1.29506 WP_002916615.1.29529 WP_002916615.1.29583 WP_002916615.1.29636 WP_002916615.1.29726 WP_002916615.1.29748 WP_002916615.1.29772 WP_002916615.1.29829 WP_002916615.1.29858 WP_002916615.1.29871 WP_002916615.1.2990 WP_002916615.1.29915 WP_002916615.1.29974 WP_002916615.1.2999 WP_002916615.1.30010 WP_002916615.1.30078 WP_002916615.1.30132 WP_002916615.1.30218 WP_002916615.1.30264 WP_002916615.1.30296 WP_002916615.1.30300 WP_002916615.1.30339 WP_002916615.1.30390 WP_002916615.1.30416 WP_002916615.1.30471 WP_002916615.1.30478 WP_002916615.1.30539 WP_002916615.1.30576 WP_002916615.1.30638 WP_002916615.1.30897 WP_002916615.1.30929 WP_002916615.1.3099 WP_002916615.1.31061 WP_002916615.1.31064 WP_002916615.1.3111 WP_002916615.1.31257 WP_002916615.1.313 WP_002916615.1.31374 WP_002916615.1.31400 WP_002916615.1.31459 WP_002916615.1.31536 WP_002916615.1.3159 WP_002916615.1.31591 WP_002916615.1.31601 WP_002916615.1.31630 WP_002916615.1.3164 WP_002916615.1.31846 WP_002916615.1.31890 WP_002916615.1.31920 WP_002916615.1.31938 WP_002916615.1.31948 WP_002916615.1.31992 WP_002916615.1.32013 WP_002916615.1.32023 WP_002916615.1.32057 WP_002916615.1.32086 WP_002916615.1.32211 WP_002916615.1.32212 WP_002916615.1.32315 WP_002916615.1.32336 WP_002916615.1.3234 WP_002916615.1.32369 WP_002916615.1.32371 WP_002916615.1.32612 WP_002916615.1.32690 WP_002916615.1.32788 WP_002916615.1.32797 WP_002916615.1.32809 WP_002916615.1.3282 WP_002916615.1.32827 WP_002916615.1.32849 WP_002916615.1.32854 WP_002916615.1.32857 WP_002916615.1.32915 WP_002916615.1.32936 WP_002916615.1.33041 WP_002916615.1.33057 WP_002916615.1.33136 WP_002916615.1.3317 WP_002916615.1.33229 WP_002916615.1.33399 WP_002916615.1.33406 WP_002916615.1.33414 WP_002916615.1.33435 WP_002916615.1.33481 WP_002916615.1.33498 WP_002916615.1.33544 WP_002916615.1.33642 WP_002916615.1.33704 WP_002916615.1.33750 WP_002916615.1.33755 WP_002916615.1.33806 WP_002916615.1.33831 WP_002916615.1.33836 WP_002916615.1.33838 WP_002916615.1.33889 WP_002916615.1.33942 WP_002916615.1.33985 WP_002916615.1.34110 WP_002916615.1.34113 WP_002916615.1.34200 WP_002916615.1.34213 WP_002916615.1.34258 WP_002916615.1.34265 WP_002916615.1.34281 WP_002916615.1.34311 WP_002916615.1.34316 WP_002916615.1.34367 WP_002916615.1.34390 WP_002916615.1.34439 WP_002916615.1.34479 WP_002916615.1.34481 WP_002916615.1.3450 WP_002916615.1.34507 WP_002916615.1.34636 WP_002916615.1.34654 WP_002916615.1.34678 WP_002916615.1.34696 WP_002916615.1.34706 WP_002916615.1.34748 WP_002916615.1.34757 WP_002916615.1.34771 WP_002916615.1.34826 WP_002916615.1.34869 WP_002916615.1.34885 WP_002916615.1.34910 WP_002916615.1.34955 WP_002916615.1.35028 WP_002916615.1.35033 WP_002916615.1.35109 WP_002916615.1.35197 WP_002916615.1.3525 WP_002916615.1.35268 WP_002916615.1.35284 WP_002916615.1.35286 WP_002916615.1.3529 WP_002916615.1.35453 WP_002916615.1.35496 WP_002916615.1.35568 WP_002916615.1.35626 WP_002916615.1.35645 WP_002916615.1.35699 WP_002916615.1.35731 WP_002916615.1.35793 WP_002916615.1.35814 WP_002916615.1.35824 WP_002916615.1.35863 WP_002916615.1.35914 WP_002916615.1.35918 WP_002916615.1.36018 WP_002916615.1.36025 WP_002916615.1.36029 WP_002916615.1.3605 WP_002916615.1.36080 WP_002916615.1.36084 WP_002916615.1.36092 WP_002916615.1.36099 WP_002916615.1.36130 WP_002916615.1.36151 WP_002916615.1.36204 WP_002916615.1.36237 WP_002916615.1.3628 WP_002916615.1.36306 WP_002916615.1.36383 WP_002916615.1.36388 WP_002916615.1.3640 WP_002916615.1.36402 WP_002916615.1.3644 WP_002916615.1.36451 WP_002916615.1.36468 WP_002916615.1.3657 WP_002916615.1.36659 WP_002916615.1.36728 WP_002916615.1.36825 WP_002916615.1.36998 WP_002916615.1.37066 WP_002916615.1.37140 WP_002916615.1.3716 WP_002916615.1.37177 WP_002916615.1.37235 WP_002916615.1.37279 WP_002916615.1.37356 WP_002916615.1.37361 WP_002916615.1.3738 WP_002916615.1.37422 WP_002916615.1.37456 WP_002916615.1.37565 WP_002916615.1.37614 WP_002916615.1.37617 WP_002916615.1.37681 WP_002916615.1.37829 WP_002916615.1.37860 WP_002916615.1.38089 WP_002916615.1.38094 WP_002916615.1.38096 WP_002916615.1.38215 WP_002916615.1.38231 WP_002916615.1.38236 WP_002916615.1.38269 WP_002916615.1.38399 WP_002916615.1.38433 WP_002916615.1.38448 WP_002916615.1.38464 WP_002916615.1.38593 WP_002916615.1.3862 WP_002916615.1.38684 WP_002916615.1.38705 WP_002916615.1.38729 WP_002916615.1.38799 WP_002916615.1.388 WP_002916615.1.38815 WP_002916615.1.38838 WP_002916615.1.38849 WP_002916615.1.38912 WP_002916615.1.38921 WP_002916615.1.39149 WP_002916615.1.39169 WP_002916615.1.39299 WP_002916615.1.39360 WP_002916615.1.39391 WP_002916615.1.39418 WP_002916615.1.39439 WP_002916615.1.39456 WP_002916615.1.39498 WP_002916615.1.39532 WP_002916615.1.39534 WP_002916615.1.39637 WP_002916615.1.39677 WP_002916615.1.39698 WP_002916615.1.39705 WP_002916615.1.39815 WP_002916615.1.3982 WP_002916615.1.39852 WP_002916615.1.39878 WP_002916615.1.3988 WP_002916615.1.40042 WP_002916615.1.40054 WP_002916615.1.40078 WP_002916615.1.40185 WP_002916615.1.40201 WP_002916615.1.40295 WP_002916615.1.4032 WP_002916615.1.40394 WP_002916615.1.40396 WP_002916615.1.40527 WP_002916615.1.40551 WP_002916615.1.40561 WP_002916615.1.40597 WP_002916615.1.40604 WP_002916615.1.40614 WP_002916615.1.4064 WP_002916615.1.40675 WP_002916615.1.4072 WP_002916615.1.40798 WP_002916615.1.40817 WP_002916615.1.40825 WP_002916615.1.40866 WP_002916615.1.40878 WP_002916615.1.40967 WP_002916615.1.4098 WP_002916615.1.41003 WP_002916615.1.41049 WP_002916615.1.41073 WP_002916615.1.41095 WP_002916615.1.41096 WP_002916615.1.41159 WP_002916615.1.41182 WP_002916615.1.41221 WP_002916615.1.41282 WP_002916615.1.41283 WP_002916615.1.4131 WP_002916615.1.41352 WP_002916615.1.41405 WP_002916615.1.4154 WP_002916615.1.41563 WP_002916615.1.41630 WP_002916615.1.41644 WP_002916615.1.41765 WP_002916615.1.4177 WP_002916615.1.41794 WP_002916615.1.41833 WP_002916615.1.41872 WP_002916615.1.41895 WP_002916615.1.41907 WP_002916615.1.41924 WP_002916615.1.41928 WP_002916615.1.41992 WP_002916615.1.42054 WP_002916615.1.42079 WP_002916615.1.42139 WP_002916615.1.42264 WP_002916615.1.42280 WP_002916615.1.42297 WP_002916615.1.42299 WP_002916615.1.42306 WP_002916615.1.42338 WP_002916615.1.42464 WP_002916615.1.42518 WP_002916615.1.42578 WP_002916615.1.42583 WP_002916615.1.42584 WP_002916615.1.42629 WP_002916615.1.42724 WP_002916615.1.42755 WP_002916615.1.4286 WP_002916615.1.42881 WP_002916615.1.42951 WP_002916615.1.42953 WP_002916615.1.43010 WP_002916615.1.43043 WP_002916615.1.43050 WP_002916615.1.43084 WP_002916615.1.4312 WP_002916615.1.43146 WP_002916615.1.43214 WP_002916615.1.43221 WP_002916615.1.43228 WP_002916615.1.43231 WP_002916615.1.43233 WP_002916615.1.43386 WP_002916615.1.43445 WP_002916615.1.4346 WP_002916615.1.43492 WP_002916615.1.4351 WP_002916615.1.4359 WP_002916615.1.43601 WP_002916615.1.43611 WP_002916615.1.43833 WP_002916615.1.43836 WP_002916615.1.43853 WP_002916615.1.43867 WP_002916615.1.43874 WP_002916615.1.4393 WP_002916615.1.44117 WP_002916615.1.4414 WP_002916615.1.44158 WP_002916615.1.4416 WP_002916615.1.44235 WP_002916615.1.44267 WP_002916615.1.4430 WP_002916615.1.44325 WP_002916615.1.44368 WP_002916615.1.44418 WP_002916615.1.44708 WP_002916615.1.44805 WP_002916615.1.44896 WP_002916615.1.44946 WP_002916615.1.45107 WP_002916615.1.45137 WP_002916615.1.45191 WP_002916615.1.45258 WP_002916615.1.45319 WP_002916615.1.45327 WP_002916615.1.45380 WP_002916615.1.45395 WP_002916615.1.45443 WP_002916615.1.45445 WP_002916615.1.45482 WP_002916615.1.45519 WP_002916615.1.45557 WP_002916615.1.45592 WP_002916615.1.45594 WP_002916615.1.45607 WP_002916615.1.45644 WP_002916615.1.45821 WP_002916615.1.45910 WP_002916615.1.45911 WP_002916615.1.45970 WP_002916615.1.46002 WP_002916615.1.46006 WP_002916615.1.46134 WP_002916615.1.46175 WP_002916615.1.46199 WP_002916615.1.46221 WP_002916615.1.46254 WP_002916615.1.46260 WP_002916615.1.46279 WP_002916615.1.46288 WP_002916615.1.46327 WP_002916615.1.46384 WP_002916615.1.46393 WP_002916615.1.46397 WP_002916615.1.46427 WP_002916615.1.46455 WP_002916615.1.4655 WP_002916615.1.46561 WP_002916615.1.46563 WP_002916615.1.4664 WP_002916615.1.46776 WP_002916615.1.46838 WP_002916615.1.46890 WP_002916615.1.4697 WP_002916615.1.46971 WP_002916615.1.46985 WP_002916615.1.47027 WP_002916615.1.47104 WP_002916615.1.47199 WP_002916615.1.47252 WP_002916615.1.47264 WP_002916615.1.47302 WP_002916615.1.47376 WP_002916615.1.47378 WP_002916615.1.47379 WP_002916615.1.47413 WP_002916615.1.47461 WP_002916615.1.47521 WP_002916615.1.47623 WP_002916615.1.47641 WP_002916615.1.47661 WP_002916615.1.47716 WP_002916615.1.47760 WP_002916615.1.47777 WP_002916615.1.47815 WP_002916615.1.4787 WP_002916615.1.47871 WP_002916615.1.47885 WP_002916615.1.47919 WP_002916615.1.47922 WP_002916615.1.47982 WP_002916615.1.48022 WP_002916615.1.48110 WP_002916615.1.48228 WP_002916615.1.48237 WP_002916615.1.48274 WP_002916615.1.48362 WP_002916615.1.48402 WP_002916615.1.48442 WP_002916615.1.48587 WP_002916615.1.48606 WP_002916615.1.48609 WP_002916615.1.48673 WP_002916615.1.48686 WP_002916615.1.48793 WP_002916615.1.48850 WP_002916615.1.48859 WP_002916615.1.48871 WP_002916615.1.48887 WP_002916615.1.48893 WP_002916615.1.48900 WP_002916615.1.48904 WP_002916615.1.48975 WP_002916615.1.4900 WP_002916615.1.49006 WP_002916615.1.49035 WP_002916615.1.49052 WP_002916615.1.49069 WP_002916615.1.49133 WP_002916615.1.49151 WP_002916615.1.49157 WP_002916615.1.49194 WP_002916615.1.49209 WP_002916615.1.49267 WP_002916615.1.49307 WP_002916615.1.49333 WP_002916615.1.49353 WP_002916615.1.49424 WP_002916615.1.49438 WP_002916615.1.49480 WP_002916615.1.49579 WP_002916615.1.49589 WP_002916615.1.49613 WP_002916615.1.49721 WP_002916615.1.49762 WP_002916615.1.49817 WP_002916615.1.49829 WP_002916615.1.49834 WP_002916615.1.49877 WP_002916615.1.49887 WP_002916615.1.49933 WP_002916615.1.50018 WP_002916615.1.50029 WP_002916615.1.50049 WP_002916615.1.50133 WP_002916615.1.50165 WP_002916615.1.50195 WP_002916615.1.5023 WP_002916615.1.5026 WP_002916615.1.50283 WP_002916615.1.50335 WP_002916615.1.50364 WP_002916615.1.50429 WP_002916615.1.50434 WP_002916615.1.50465 WP_002916615.1.5054 WP_002916615.1.50541 WP_002916615.1.5057 WP_002916615.1.50619 WP_002916615.1.50672 WP_002916615.1.50693 WP_002916615.1.50730 WP_002916615.1.50823 WP_002916615.1.50831 WP_002916615.1.50866 WP_002916615.1.50910 WP_002916615.1.50927 WP_002916615.1.50992 WP_002916615.1.51016 WP_002916615.1.51090 WP_002916615.1.51105 WP_002916615.1.51132 WP_002916615.1.51135 WP_002916615.1.51176 WP_002916615.1.51181 WP_002916615.1.51311 WP_002916615.1.51312 WP_002916615.1.51347 WP_002916615.1.51372 WP_002916615.1.51390 WP_002916615.1.5140 WP_002916615.1.51400 WP_002916615.1.51401 WP_002916615.1.5143 WP_002916615.1.51438 WP_002916615.1.51479 WP_002916615.1.51560 WP_002916615.1.51561 WP_002916615.1.51563 WP_002916615.1.51599 WP_002916615.1.51614 WP_002916615.1.51670 WP_002916615.1.51688 WP_002916615.1.51698 WP_002916615.1.51743 WP_002916615.1.51779 WP_002916615.1.51791 WP_002916615.1.5181 WP_002916615.1.51885 WP_002916615.1.51907 WP_002916615.1.51922 WP_002916615.1.51965 WP_002916615.1.51975 WP_002916615.1.52012 WP_002916615.1.52021 WP_002916615.1.52054 WP_002916615.1.52079 WP_002916615.1.522 WP_002916615.1.52215 WP_002916615.1.52275 WP_002916615.1.52287 WP_002916615.1.52288 WP_002916615.1.52309 WP_002916615.1.52368 WP_002916615.1.52425 WP_002916615.1.52477 WP_002916615.1.52534 WP_002916615.1.5259 WP_002916615.1.52609 WP_002916615.1.52635 WP_002916615.1.52678 WP_002916615.1.52703 WP_002916615.1.52775 WP_002916615.1.52813 WP_002916615.1.52920 WP_002916615.1.52927 WP_002916615.1.52929 WP_002916615.1.52954 WP_002916615.1.53015 WP_002916615.1.53388 WP_002916615.1.53391 WP_002916615.1.53442 WP_002916615.1.53461 WP_002916615.1.53472 WP_002916615.1.53484 WP_002916615.1.53568 WP_002916615.1.53585 WP_002916615.1.53588 WP_002916615.1.53623 WP_002916615.1.53716 WP_002916615.1.53727 WP_002916615.1.53734 WP_002916615.1.53817 WP_002916615.1.53834 WP_002916615.1.53897 WP_002916615.1.53967 WP_002916615.1.53990 WP_002916615.1.540 WP_002916615.1.54011 WP_002916615.1.54045 WP_002916615.1.5406 WP_002916615.1.54129 WP_002916615.1.54448 WP_002916615.1.54556 WP_002916615.1.54676 WP_002916615.1.54739 WP_002916615.1.54786 WP_002916615.1.54824 WP_002916615.1.54952 WP_002916615.1.54958 WP_002916615.1.55032 WP_002916615.1.55048 WP_002916615.1.55050 WP_002916615.1.551 WP_002916615.1.55171 WP_002916615.1.55188 WP_002916615.1.55228 WP_002916615.1.55264 WP_002916615.1.55330 WP_002916615.1.5535 WP_002916615.1.55351 WP_002916615.1.55364 WP_002916615.1.55382 WP_002916615.1.55448 WP_002916615.1.55515 WP_002916615.1.55577 WP_002916615.1.55580 WP_002916615.1.55632 WP_002916615.1.55648 WP_002916615.1.55651 WP_002916615.1.55658 WP_002916615.1.55738 WP_002916615.1.55741 WP_002916615.1.5576 WP_002916615.1.55801 WP_002916615.1.55863 WP_002916615.1.55866 WP_002916615.1.55869 WP_002916615.1.56017 WP_002916615.1.56104 WP_002916615.1.56118 WP_002916615.1.56125 WP_002916615.1.56195 WP_002916615.1.56331 WP_002916615.1.5634 WP_002916615.1.56506 WP_002916615.1.56551 WP_002916615.1.56599 WP_002916615.1.56604 WP_002916615.1.56674 WP_002916615.1.56728 WP_002916615.1.56750 WP_002916615.1.5682 WP_002916615.1.56847 WP_002916615.1.56897 WP_002916615.1.57112 WP_002916615.1.57139 WP_002916615.1.57310 WP_002916615.1.57325 WP_002916615.1.57398 WP_002916615.1.57421 WP_002916615.1.57455 WP_002916615.1.57497 WP_002916615.1.57501 WP_002916615.1.57618 WP_002916615.1.57624 WP_002916615.1.57630 WP_002916615.1.57643 WP_002916615.1.57648 WP_002916615.1.57662 WP_002916615.1.57716 WP_002916615.1.57747 WP_002916615.1.57886 WP_002916615.1.57914 WP_002916615.1.57993 WP_002916615.1.58028 WP_002916615.1.58091 WP_002916615.1.58099 WP_002916615.1.58118 WP_002916615.1.58134 WP_002916615.1.58224 WP_002916615.1.58280 WP_002916615.1.58307 WP_002916615.1.5831 WP_002916615.1.58399 WP_002916615.1.58426 WP_002916615.1.58466 WP_002916615.1.58479 WP_002916615.1.58533 WP_002916615.1.58579 WP_002916615.1.58594 WP_002916615.1.58631 WP_002916615.1.58685 WP_002916615.1.58720 WP_002916615.1.58865 WP_002916615.1.58873 WP_002916615.1.58890 WP_002916615.1.58914 WP_002916615.1.58967 WP_002916615.1.58980 WP_002916615.1.58985 WP_002916615.1.58994 WP_002916615.1.59015 WP_002916615.1.5903 WP_002916615.1.59031 WP_002916615.1.59115 WP_002916615.1.59172 WP_002916615.1.59279 WP_002916615.1.59485 WP_002916615.1.59518 WP_002916615.1.59557 WP_002916615.1.59559 WP_002916615.1.59600 WP_002916615.1.59616 WP_002916615.1.59661 WP_002916615.1.59708 WP_002916615.1.59729 WP_002916615.1.5975 WP_002916615.1.59796 WP_002916615.1.59840 WP_002916615.1.59865 WP_002916615.1.59873 WP_002916615.1.59924 WP_002916615.1.59936 WP_002916615.1.59972 WP_002916615.1.59993 WP_002916615.1.59996 WP_002916615.1.60060 WP_002916615.1.60074 WP_002916615.1.60266 WP_002916615.1.60276 WP_002916615.1.60283 WP_002916615.1.60336 WP_002916615.1.60372 WP_002916615.1.60416 WP_002916615.1.6042 WP_002916615.1.60483 WP_002916615.1.60511 WP_002916615.1.60534 WP_002916615.1.60611 WP_002916615.1.60681 WP_002916615.1.60745 WP_002916615.1.60774 WP_002916615.1.60843 WP_002916615.1.60861 WP_002916615.1.6089 WP_002916615.1.60905 WP_002916615.1.60922 WP_002916615.1.60964 WP_002916615.1.60972 WP_002916615.1.6099 WP_002916615.1.60995 WP_002916615.1.61178 WP_002916615.1.6122 WP_002916615.1.61272 WP_002916615.1.61416 WP_002916615.1.61572 WP_002916615.1.61672 WP_002916615.1.61775 WP_002916615.1.6180 WP_002916615.1.61812 WP_002916615.1.61898 WP_002916615.1.61940 WP_002916615.1.61973 WP_002916615.1.61994 WP_002916615.1.620 WP_002916615.1.62050 WP_002916615.1.62082 WP_002916615.1.62090 WP_002916615.1.62111 WP_002916615.1.62126 WP_002916615.1.62188 WP_002916615.1.62226 WP_002916615.1.62234 WP_002916615.1.62278 WP_002916615.1.62292 WP_002916615.1.62294 WP_002916615.1.62306 WP_002916615.1.62400 WP_002916615.1.62473 WP_002916615.1.62501 WP_002916615.1.62520 WP_002916615.1.62579 WP_002916615.1.62603 WP_002916615.1.6265 WP_002916615.1.62664 WP_002916615.1.62719 WP_002916615.1.62733 WP_002916615.1.62765 WP_002916615.1.62783 WP_002916615.1.62809 WP_002916615.1.6302 WP_002916615.1.63098 WP_002916615.1.63123 WP_002916615.1.63164 WP_002916615.1.63294 WP_002916615.1.63309 WP_002916615.1.63351 WP_002916615.1.63395 WP_002916615.1.63404 WP_002916615.1.6346 WP_002916615.1.6347 WP_002916615.1.63552 WP_002916615.1.63671 WP_002916615.1.63750 WP_002916615.1.63785 WP_002916615.1.63802 WP_002916615.1.6391 WP_002916615.1.63956 WP_002916615.1.63968 WP_002916615.1.63972 WP_002916615.1.64001 WP_002916615.1.64075 WP_002916615.1.64099 WP_002916615.1.64187 WP_002916615.1.64191 WP_002916615.1.64240 WP_002916615.1.6432 WP_002916615.1.64348 WP_002916615.1.64427 WP_002916615.1.64453 WP_002916615.1.64593 WP_002916615.1.64620 WP_002916615.1.6476 WP_002916615.1.64768 WP_002916615.1.64826 WP_002916615.1.64852 WP_002916615.1.64865 WP_002916615.1.64914 WP_002916615.1.64945 WP_002916615.1.65021 WP_002916615.1.65042 WP_002916615.1.65043 WP_002916615.1.65077 WP_002916615.1.65108 WP_002916615.1.65215 WP_002916615.1.6524 WP_002916615.1.65254 WP_002916615.1.65398 WP_002916615.1.65421 WP_002916615.1.65436 WP_002916615.1.65552 WP_002916615.1.65611 WP_002916615.1.65723 WP_002916615.1.65745 WP_002916615.1.65766 WP_002916615.1.65845 WP_002916615.1.6591 WP_002916615.1.66019 WP_002916615.1.66020 WP_002916615.1.66047 WP_002916615.1.66070 WP_002916615.1.6610 WP_002916615.1.66108 WP_002916615.1.66152 WP_002916615.1.66236 WP_002916615.1.66271 WP_002916615.1.66292 WP_002916615.1.66294 WP_002916615.1.66339 WP_002916615.1.66409 WP_002916615.1.66415 WP_002916615.1.66430 WP_002916615.1.66434 WP_002916615.1.6644 WP_002916615.1.66481 WP_002916615.1.66529 WP_002916615.1.66555 WP_002916615.1.66568 WP_002916615.1.66577 WP_002916615.1.66597 WP_002916615.1.66613 WP_002916615.1.66670 WP_002916615.1.6670 WP_002916615.1.66709 WP_002916615.1.66714 WP_002916615.1.66740 WP_002916615.1.66753 WP_002916615.1.6678 WP_002916615.1.66839 WP_002916615.1.66857 WP_002916615.1.66895 WP_002916615.1.66896 WP_002916615.1.66947 WP_002916615.1.66989 WP_002916615.1.6715 WP_002916615.1.67313 WP_002916615.1.67399 WP_002916615.1.67492 WP_002916615.1.67512 WP_002916615.1.6754 WP_002916615.1.67591 WP_002916615.1.67765 WP_002916615.1.67766 WP_002916615.1.6779 WP_002916615.1.67805 WP_002916615.1.67858 WP_002916615.1.67936 WP_002916615.1.67946 WP_002916615.1.68090 WP_002916615.1.68189 WP_002916615.1.6823 WP_002916615.1.68403 WP_002916615.1.68491 WP_002916615.1.68507 WP_002916615.1.68511 WP_002916615.1.68519 WP_002916615.1.68533 WP_002916615.1.68543 WP_002916615.1.68659 WP_002916615.1.68768 WP_002916615.1.68844 WP_002916615.1.6885 WP_002916615.1.68940 WP_002916615.1.68946 WP_002916615.1.68986 WP_002916615.1.69002 WP_002916615.1.69027 WP_002916615.1.69153 WP_002916615.1.69212 WP_002916615.1.69268 WP_002916615.1.69384 WP_002916615.1.69453 WP_002916615.1.69459 WP_002916615.1.69576 WP_002916615.1.69595 WP_002916615.1.69613 WP_002916615.1.69635 WP_002916615.1.69637 WP_002916615.1.69691 WP_002916615.1.69719 WP_002916615.1.69738 WP_002916615.1.69744 WP_002916615.1.69753 WP_002916615.1.69836 WP_002916615.1.69861 WP_002916615.1.69915 WP_002916615.1.69947 WP_002916615.1.6997 WP_002916615.1.7000 WP_002916615.1.70009 WP_002916615.1.70050 WP_002916615.1.70101 WP_002916615.1.70112 WP_002916615.1.70140 WP_002916615.1.702 WP_002916615.1.70499 WP_002916615.1.70519 WP_002916615.1.70543 WP_002916615.1.70681 WP_002916615.1.70718 WP_002916615.1.7072 WP_002916615.1.70765 WP_002916615.1.70847 WP_002916615.1.70859 WP_002916615.1.7087 WP_002916615.1.70870 WP_002916615.1.70873 WP_002916615.1.70966 WP_002916615.1.71056 WP_002916615.1.71092 WP_002916615.1.71100 WP_002916615.1.71212 WP_002916615.1.71241 WP_002916615.1.71286 WP_002916615.1.71291 WP_002916615.1.71296 WP_002916615.1.7136 WP_002916615.1.71504 WP_002916615.1.71611 WP_002916615.1.71625 WP_002916615.1.71634 WP_002916615.1.71704 WP_002916615.1.71720 WP_002916615.1.71751 WP_002916615.1.7181 WP_002916615.1.71913 WP_002916615.1.72139 WP_002916615.1.72201 WP_002916615.1.72214 WP_002916615.1.7223 WP_002916615.1.72274 WP_002916615.1.72341 WP_002916615.1.72406 WP_002916615.1.72482 WP_002916615.1.72575 WP_002916615.1.72597 WP_002916615.1.72609 WP_002916615.1.72632 WP_002916615.1.72673 WP_002916615.1.72688 WP_002916615.1.72713 WP_002916615.1.7273 WP_002916615.1.72735 WP_002916615.1.72746 WP_002916615.1.72763 WP_002916615.1.72765 WP_002916615.1.72899 WP_002916615.1.73009 WP_002916615.1.73038 WP_002916615.1.7320 WP_002916615.1.73208 WP_002916615.1.73236 WP_002916615.1.73301 WP_002916615.1.73316 WP_002916615.1.73319 WP_002916615.1.73332 WP_002916615.1.73472 WP_002916615.1.73510 WP_002916615.1.73558 WP_002916615.1.73562 WP_002916615.1.73589 WP_002916615.1.73689 WP_002916615.1.73691 WP_002916615.1.73732 WP_002916615.1.73742 WP_002916615.1.73770 WP_002916615.1.73780 WP_002916615.1.7390 WP_002916615.1.73904 WP_002916615.1.740 WP_002916615.1.74001 WP_002916615.1.74048 WP_002916615.1.74110 WP_002916615.1.74176 WP_002916615.1.74253 WP_002916615.1.74256 WP_002916615.1.74357 WP_002916615.1.74490 WP_002916615.1.7455 WP_002916615.1.747 WP_002916615.1.74715 WP_002916615.1.74732 WP_002916615.1.74759 WP_002916615.1.74788 WP_002916615.1.74817 WP_002916615.1.74847 WP_002916615.1.74905 WP_002916615.1.74909 WP_002916615.1.74919 WP_002916615.1.74981 WP_002916615.1.75005 WP_002916615.1.75007 WP_002916615.1.75013 WP_002916615.1.75014 WP_002916615.1.75035 WP_002916615.1.75115 WP_002916615.1.75152 WP_002916615.1.75283 WP_002916615.1.75307 WP_002916615.1.75366 WP_002916615.1.75396 WP_002916615.1.75398 WP_002916615.1.75418 WP_002916615.1.75457 WP_002916615.1.75501 WP_002916615.1.75561 WP_002916615.1.75572 WP_002916615.1.75592 WP_002916615.1.75608 WP_002916615.1.75625 WP_002916615.1.75637 WP_002916615.1.75719 WP_002916615.1.7574 WP_002916615.1.7578 WP_002916615.1.75829 WP_002916615.1.75832 WP_002916615.1.75888 WP_002916615.1.75909 WP_002916615.1.75961 WP_002916615.1.75962 WP_002916615.1.76090 WP_002916615.1.76107 WP_002916615.1.76199 WP_002916615.1.76245 WP_002916615.1.76292 WP_002916615.1.76316 WP_002916615.1.76370 WP_002916615.1.76412 WP_002916615.1.76416 WP_002916615.1.7649 WP_002916615.1.76496 WP_002916615.1.76512 WP_002916615.1.76537 WP_002916615.1.76539 WP_002916615.1.76561 WP_002916615.1.76657 WP_002916615.1.76819 WP_002916615.1.76889 WP_002916615.1.76912 WP_002916615.1.76935 WP_002916615.1.76943 WP_002916615.1.76991 WP_002916615.1.77034 WP_002916615.1.77077 WP_002916615.1.77085 WP_002916615.1.77105 WP_002916615.1.77211 WP_002916615.1.77304 WP_002916615.1.7733 WP_002916615.1.77340 WP_002916615.1.77367 WP_002916615.1.77516 WP_002916615.1.77547 WP_002916615.1.77586 WP_002916615.1.77645 WP_002916615.1.77655 WP_002916615.1.7773 WP_002916615.1.77799 WP_002916615.1.77800 WP_002916615.1.77802 WP_002916615.1.77831 WP_002916615.1.77875 WP_002916615.1.78012 WP_002916615.1.78065 WP_002916615.1.78103 WP_002916615.1.7811 WP_002916615.1.78119 WP_002916615.1.78171 WP_002916615.1.78214 WP_002916615.1.78260 WP_002916615.1.78268 WP_002916615.1.78290 WP_002916615.1.78300 WP_002916615.1.78334 WP_002916615.1.78350 WP_002916615.1.78354 WP_002916615.1.78387 WP_002916615.1.78421 WP_002916615.1.78472 WP_002916615.1.78533 WP_002916615.1.78540 WP_002916615.1.78591 WP_002916615.1.78597 WP_002916615.1.78725 WP_002916615.1.78745 WP_002916615.1.78772 WP_002916615.1.78861 WP_002916615.1.78922 WP_002916615.1.78950 WP_002916615.1.78962 WP_002916615.1.78981 WP_002916615.1.79021 WP_002916615.1.79091 WP_002916615.1.79108 WP_002916615.1.79109 WP_002916615.1.79141 WP_002916615.1.79175 WP_002916615.1.79211 WP_002916615.1.79266 WP_002916615.1.7935 WP_002916615.1.79520 WP_002916615.1.79541 WP_002916615.1.79582 WP_002916615.1.79608 WP_002916615.1.79625 WP_002916615.1.79636 WP_002916615.1.7974 WP_002916615.1.79756 WP_002916615.1.79857 WP_002916615.1.79868 WP_002916615.1.79935 WP_002916615.1.8001 WP_002916615.1.80027 WP_002916615.1.80047 WP_002916615.1.80217 WP_002916615.1.80227 WP_002916615.1.80350 WP_002916615.1.80362 WP_002916615.1.80412 WP_002916615.1.80466 WP_002916615.1.80554 WP_002916615.1.8056 WP_002916615.1.80615 WP_002916615.1.80692 WP_002916615.1.807 WP_002916615.1.80771 WP_002916615.1.80772 WP_002916615.1.80816 WP_002916615.1.80829 WP_002916615.1.81122 WP_002916615.1.81139 WP_002916615.1.81144 WP_002916615.1.81159 WP_002916615.1.81212 WP_002916615.1.81235 WP_002916615.1.81255 WP_002916615.1.81329 WP_002916615.1.81350 WP_002916615.1.81449 WP_002916615.1.81452 WP_002916615.1.81488 WP_002916615.1.81544 WP_002916615.1.81569 WP_002916615.1.81633 WP_002916615.1.81675 WP_002916615.1.81683 WP_002916615.1.81759 WP_002916615.1.81835 WP_002916615.1.81841 WP_002916615.1.81851 WP_002916615.1.81908 WP_002916615.1.82003 WP_002916615.1.82022 WP_002916615.1.82034 WP_002916615.1.82129 WP_002916615.1.82170 WP_002916615.1.82211 WP_002916615.1.82238 WP_002916615.1.82299 WP_002916615.1.82370 WP_002916615.1.82399 WP_002916615.1.82446 WP_002916615.1.82452 WP_002916615.1.8252 WP_002916615.1.82659 WP_002916615.1.82767 WP_002916615.1.82769 WP_002916615.1.8296 WP_002916615.1.83014 WP_002916615.1.83022 WP_002916615.1.83076 WP_002916615.1.83263 WP_002916615.1.83285 WP_002916615.1.83337 WP_002916615.1.83379 WP_002916615.1.83387 WP_002916615.1.83556 WP_002916615.1.83608 WP_002916615.1.83691 WP_002916615.1.83746 WP_002916615.1.83948 WP_002916615.1.84066 WP_002916615.1.84128 WP_002916615.1.84315 WP_002916615.1.84335 WP_002916615.1.84377 WP_002916615.1.84417 WP_002916615.1.84549 WP_002916615.1.84560 WP_002916615.1.84569 WP_002916615.1.84627 WP_002916615.1.8464 WP_002916615.1.84650 WP_002916615.1.84737 WP_002916615.1.84783 WP_002916615.1.84787 WP_002916615.1.84801 WP_002916615.1.84890 WP_002916615.1.84900 WP_002916615.1.85005 WP_002916615.1.85010 WP_002916615.1.85063 WP_002916615.1.85102 WP_002916615.1.85115 WP_002916615.1.85191 WP_002916615.1.85193 WP_002916615.1.85263 WP_002916615.1.85366 WP_002916615.1.85390 WP_002916615.1.85423 WP_002916615.1.85487 WP_002916615.1.8549 WP_002916615.1.85497 WP_002916615.1.85539 WP_002916615.1.85564 WP_002916615.1.85571 WP_002916615.1.85622 WP_002916615.1.85680 WP_002916615.1.85702 WP_002916615.1.85731 WP_002916615.1.85761 WP_002916615.1.85783 WP_002916615.1.85785 WP_002916615.1.858 WP_002916615.1.85805 WP_002916615.1.85812 WP_002916615.1.85877 WP_002916615.1.85954 WP_002916615.1.85957 WP_002916615.1.85965 WP_002916615.1.85970 WP_002916615.1.85985 WP_002916615.1.86031 WP_002916615.1.86039 WP_002916615.1.86074 WP_002916615.1.86169 WP_002916615.1.86194 WP_002916615.1.86302 WP_002916615.1.86339 WP_002916615.1.86384 WP_002916615.1.86528 WP_002916615.1.86533 WP_002916615.1.86556 WP_002916615.1.86668 WP_002916615.1.8667 WP_002916615.1.8668 WP_002916615.1.86778 WP_002916615.1.86835 WP_002916615.1.86899 WP_002916615.1.86932 WP_002916615.1.86946 WP_002916615.1.87 WP_002916615.1.87027 WP_002916615.1.87063 WP_002916615.1.87112 WP_002916615.1.87113 WP_002916615.1.87132 WP_002916615.1.87140 WP_002916615.1.87150 WP_002916615.1.87202 WP_002916615.1.87214 WP_002916615.1.87235 WP_002916615.1.87256 WP_002916615.1.87313 WP_002916615.1.87315 WP_002916615.1.87343 WP_002916615.1.87354 WP_002916615.1.87392 WP_002916615.1.87402 WP_002916615.1.87437 WP_002916615.1.87441 WP_002916615.1.87591 WP_002916615.1.87628 WP_002916615.1.8763 WP_002916615.1.87631 WP_002916615.1.87638 WP_002916615.1.87645 WP_002916615.1.87693 WP_002916615.1.8775 WP_002916615.1.87767 WP_002916615.1.87793 WP_002916615.1.87907 WP_002916615.1.87929 WP_002916615.1.87931 WP_002916615.1.87962 WP_002916615.1.88097 WP_002916615.1.88186 WP_002916615.1.88274 WP_002916615.1.88298 WP_002916615.1.8832 WP_002916615.1.88406 WP_002916615.1.88419 WP_002916615.1.88500 WP_002916615.1.8851 WP_002916615.1.8853 WP_002916615.1.88551 WP_002916615.1.88568 WP_002916615.1.88574 WP_002916615.1.88615 WP_002916615.1.88655 WP_002916615.1.88702 WP_002916615.1.88823 WP_002916615.1.88870 WP_002916615.1.88875 WP_002916615.1.88885 WP_002916615.1.88914 WP_002916615.1.8896 WP_002916615.1.8905 WP_002916615.1.89072 WP_002916615.1.89096 WP_002916615.1.89110 WP_002916615.1.89115 WP_002916615.1.89117 WP_002916615.1.89142 WP_002916615.1.89154 WP_002916615.1.89185 WP_002916615.1.89259 WP_002916615.1.89300 WP_002916615.1.89315 WP_002916615.1.89318 WP_002916615.1.89326 WP_002916615.1.89327 WP_002916615.1.89340 WP_002916615.1.89430 WP_002916615.1.89467 WP_002916615.1.8952 WP_002916615.1.89524 WP_002916615.1.89530 WP_002916615.1.89558 WP_002916615.1.89593 WP_002916615.1.89602 WP_002916615.1.8966 WP_002916615.1.89692 WP_002916615.1.89722 WP_002916615.1.89919 WP_002916615.1.89958 WP_002916615.1.89961 WP_002916615.1.8999 WP_002916615.1.89991 WP_002916615.1.90020 WP_002916615.1.90051 WP_002916615.1.901 WP_002916615.1.90123 WP_002916615.1.90142 WP_002916615.1.9025 WP_002916615.1.90297 WP_002916615.1.90318 WP_002916615.1.90374 WP_002916615.1.90382 WP_002916615.1.90446 WP_002916615.1.90493 WP_002916615.1.90515 WP_002916615.1.90516 WP_002916615.1.90621 WP_002916615.1.90636 WP_002916615.1.90662 WP_002916615.1.90699 WP_002916615.1.90746 WP_002916615.1.90802 WP_002916615.1.90870 WP_002916615.1.90877 WP_002916615.1.90879 WP_002916615.1.90904 WP_002916615.1.90947 WP_002916615.1.90993 WP_002916615.1.91001 WP_002916615.1.91033 WP_002916615.1.9111 WP_002916615.1.91134 WP_002916615.1.91181 WP_002916615.1.91187 WP_002916615.1.91242 WP_002916615.1.91298 WP_002916615.1.91319 WP_002916615.1.91327 WP_002916615.1.91435 WP_002916615.1.91444 WP_002916615.1.91452 WP_002916615.1.91461 WP_002916615.1.91522 WP_002916615.1.91534 WP_002916615.1.91544 WP_002916615.1.91550 WP_002916615.1.91604 WP_002916615.1.91613 WP_002916615.1.91676 WP_002916615.1.91678 WP_002916615.1.91725 WP_002916615.1.91729 WP_002916615.1.91738 WP_002916615.1.91751 WP_002916615.1.91842 WP_002916615.1.91847 WP_002916615.1.91900 WP_002916615.1.91981 WP_002916615.1.92020 WP_002916615.1.92035 WP_002916615.1.92046 WP_002916615.1.92066 WP_002916615.1.92084 WP_002916615.1.92117 WP_002916615.1.9216 WP_002916615.1.92174 WP_002916615.1.92189 WP_002916615.1.92246 WP_002916615.1.92280 WP_002916615.1.92393 WP_002916615.1.925 WP_002916615.1.92569 WP_002916615.1.9258 WP_002916615.1.92601 WP_002916615.1.92704 WP_002916615.1.92746 WP_002916615.1.92771 WP_002916615.1.92782 WP_002916615.1.92873 WP_002916615.1.92901 WP_002916615.1.9300 WP_002916615.1.93004 WP_002916615.1.93031 WP_002916615.1.93058 WP_002916615.1.93070 WP_002916615.1.93081 WP_002916615.1.93131 WP_002916615.1.93132 WP_002916615.1.93161 WP_002916615.1.93226 WP_002916615.1.93246 WP_002916615.1.93256 WP_002916615.1.93278 WP_002916615.1.93342 WP_002916615.1.93369 WP_002916615.1.93445 WP_002916615.1.93502 WP_002916615.1.9353 WP_002916615.1.93685 WP_002916615.1.93757 WP_002916615.1.93764 WP_002916615.1.93879 WP_002916615.1.94021 WP_002916615.1.94033 WP_002916615.1.94163 WP_002916615.1.94200 WP_002916615.1.94290 WP_002916615.1.94518 WP_002916615.1.94599 WP_002916615.1.94605 WP_002916615.1.94608 WP_002916615.1.94642 WP_002916615.1.94696 WP_002916615.1.94701 WP_002916615.1.94721 WP_002916615.1.94777 WP_002916615.1.94837 WP_002916615.1.94860 WP_002916615.1.94871 WP_002916615.1.94894 WP_002916615.1.9492 WP_002916615.1.94956 WP_002916615.1.95021 WP_002916615.1.95030 WP_002916615.1.9511 WP_002916615.1.95122 WP_002916615.1.95189 WP_002916615.1.9521 WP_002916615.1.95238 WP_002916615.1.95299 WP_002916615.1.95349 WP_002916615.1.95405 WP_002916615.1.95429 WP_002916615.1.95486 WP_002916615.1.95524 WP_002916615.1.95527 WP_002916615.1.95593 WP_002916615.1.95697 WP_002916615.1.95710 WP_002916615.1.95723 WP_002916615.1.95743 WP_002916615.1.95754 WP_002916615.1.95843 WP_002916615.1.95889 WP_002916615.1.95898 WP_002916615.1.95927 WP_002916615.1.96010 WP_002916615.1.96202 WP_002916615.1.96225 WP_002916615.1.9626 WP_002916615.1.96300 WP_002916615.1.96374 WP_002916615.1.96375 WP_002916615.1.96383 WP_002916615.1.96405 WP_002916615.1.9651 WP_002916615.1.96645 WP_002916615.1.96653 WP_002916615.1.96684 WP_002916615.1.96737 WP_002916615.1.96774 WP_002916615.1.96793 WP_002916615.1.96802 WP_002916615.1.96842 WP_002916615.1.96881 WP_002916615.1.96915 WP_002916615.1.96979 WP_002916615.1.97025 WP_002916615.1.97037 WP_002916615.1.97114 WP_002916615.1.97197 WP_002916615.1.97249 WP_002916615.1.97263 WP_002916615.1.97333 WP_002916615.1.97419 WP_002916615.1.9745 WP_002916615.1.97463 WP_002916615.1.97500 WP_002916615.1.97567 WP_002916615.1.97636 WP_002916615.1.97680 WP_002916615.1.97697 WP_002916615.1.97728 WP_002916615.1.97734 WP_002916615.1.97759 WP_002916615.1.97773 WP_002916615.1.97833 WP_002916615.1.97855 WP_002916615.1.9800 WP_002916615.1.98024 WP_002916615.1.98125 WP_002916615.1.98184 WP_002916615.1.98278 WP_002916615.1.9831 WP_002916615.1.98311 WP_002916615.1.98320 WP_002916615.1.98336 WP_002916615.1.98342 WP_002916615.1.98408 WP_002916615.1.98420 WP_002916615.1.98450 WP_002916615.1.98499 WP_002916615.1.98553 WP_002916615.1.98631 WP_002916615.1.98728 WP_002916615.1.9875 WP_002916615.1.98816 WP_002916615.1.98871 WP_002916615.1.98932 WP_002916615.1.98973 WP_002916615.1.99007 WP_002916615.1.99013 WP_002916615.1.99016 WP_002916615.1.99166 WP_002916615.1.99245 WP_002916615.1.99248 WP_002916615.1.99264 WP_002916615.1.9934 WP_002916615.1.99348 WP_002916615.1.99691 WP_002916615.1.99705 WP_002916615.1.99706 WP_002916615.1.99778 WP_002916615.1.99794 WP_002916615.1.99873 WP_002916615.1.99885 WP_002916615.1.99944 WP_002916615.1.9996 YP_005228758.1.24690 gi|530628647|ref|YP_008423915.1| gi|238896485|ref|YP_002921223.1| gi|152971906|ref|YP_001337015.1| gi|386036536|ref|YP_005956449.1| gi|550446198|ref|YP_008661970.1| gi|402779016|ref|YP_006634562.1| 272620.KPN_03388 484021.KP1_4665 gi|378980617|ref|YP_005228758.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]