SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238896607|ref|YP_002921352.1| from Klebsiella pneumoniae NTUH-K2044

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238896607|ref|YP_002921352.1|
Domain Number 1 Region: 3-363
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 2.62e-108
Family FMN-linked oxidoreductases 0.0000000000634
Further Details:      
 
Domain Number 2 Region: 334-520
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.71e-41
Family N-terminal domain of adrenodoxin reductase-like 0.00000152
Further Details:      
 
Domain Number 3 Region: 462-519,557-651
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.7e-24
Family C-terminal domain of adrenodoxin reductase-like 0.00000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|238896607|ref|YP_002921352.1|
Sequence length 673
Comment 2,4-dieonyl-CoA reductase [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
Sequence
MSRYPSLFAPLELGFTTLKNRVLMGSMHTGLEELPDGAQRLAAFYAERARHGVALIVTGG
IAPAPSGVTMAGGAVLNDASHLAHHRHITDAVHQEGGKIALQILHTGRYSYQPALVAPSA
LQAPINRFTPHELSHDEILTLIDDFAHCAQLAREAGYDGVEVMGSEGYLINEFLAARTNQ
RDDQWGGDYARRMRFAVEVVKAVRQRAGHDFIIIYRLSMLDLVNDGSTLAEVTELAKAIE
AAGATIINTGIGWHEARIPTIATPVPRGAFSWVTRKLKGAVSIPLITTNRINDPQVAEDI
LARGDADMVSMARPFLADAEFISKAQDDRADQINTCIGCNQACLDRIFVGKVTSCLVNPR
ACHETLMPVLPANAPKRLAVVGAGPAGLAFAVNAAARGHHVTLFDALPEIGGQFNIAKQI
PGKEEFHETLRYYRTMLDLHGVDLRLNTRVTTDDLLAFDETILATGIAPRLPAIDGIEHP
KVLSYLDVLRDKAPVGAKVAIIGCGGIGFDTAMFLSQSGAATSQDIGEFCREWGIDTSLQ
TAGGLSAEGPQLSKSPRQIVMLQRKASKPGEGLGKTTGWIHRATLLARGVKMIPAVSYEK
IDDEGLHVTIGGERQLLAVDQVVICAGQEPRRELADPLRAAGKTVHLIGGCDVAAELDAR
RAIAQGTKLALAI
Download sequence
Identical sequences A0A1B2ZQT4
gi|402778895|ref|YP_006634441.1| 484021.KP1_4808 WP_004185776.1.101332 WP_004185776.1.101526 WP_004185776.1.12939 WP_004185776.1.1513 WP_004185776.1.19533 WP_004185776.1.28375 WP_004185776.1.30078 WP_004185776.1.31064 WP_004185776.1.3282 WP_004185776.1.33057 WP_004185776.1.33806 WP_004185776.1.3640 WP_004185776.1.43874 WP_004185776.1.44117 WP_004185776.1.46199 WP_004185776.1.46327 WP_004185776.1.48587 WP_004185776.1.54958 WP_004185776.1.55648 WP_004185776.1.58280 WP_004185776.1.60995 WP_004185776.1.6391 WP_004185776.1.64075 WP_004185776.1.66409 WP_004185776.1.66434 WP_004185776.1.66895 WP_004185776.1.66989 WP_004185776.1.73770 WP_004185776.1.75152 WP_004185776.1.78354 WP_004185776.1.81159 WP_004185776.1.81235 WP_004185776.1.81544 WP_004185776.1.81744 WP_004185776.1.83948 WP_004185776.1.8832 WP_004185776.1.93161 WP_004185776.1.94608 WP_004185776.1.95743 WP_004185776.1.96645 WP_004185776.1.97728 gi|238896607|ref|YP_002921352.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]