SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|550990223|ref|YP_008680833.1| from Candidatus Symbiobacter mobilis Comamonadaceae bacterium CR

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|550990223|ref|YP_008680833.1|
Domain Number 1 Region: 63-194
Classification Level Classification E-value
Superfamily CBS-domain pair 3.16e-27
Family CBS-domain pair 0.003
Further Details:      
 
Domain Number 2 Region: 201-288
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 0.00000000000000273
Family CorC/HlyC domain-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|550990223|ref|YP_008680833.1|
Sequence length 290
Comment magnesium/cobalt transporter [Candidatus Symbiobacter mobilis CR]
Sequence
MNDHSAPPLDGEDKRTLLQKIAEFIHPGPDSTSELLDTLLRAERQELIPTDSRHMLEGVI
RMAEMSAGDVMVPSARMDMIDLGAMPEVMLDGVICSGHSRYPVFEGRRENIVGVLLAKDL
LKWHRNPGIEVRSLLRPAVFVPESKRLNDLLRDFQSNHNHLAIVIDEYGEVAGLITIEDV
LEVIVGDIEDEFDSGKSEGSIYDVPDHSYTVSGDSPIERVEYVLGIHIDRSNSAEEQELD
TIGGLIAHRMGHVPQRGEHYELCGLRFSVVYAKGGYVQWFNVRHPDDAPQ
Download sequence
Identical sequences U5N619
gi|550990223|ref|YP_008680833.1| WP_022771551.1.16511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]