SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|550990772|ref|YP_008681382.1| from Candidatus Symbiobacter mobilis Comamonadaceae bacterium CR

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|550990772|ref|YP_008681382.1|
Domain Number 1 Region: 198-336
Classification Level Classification E-value
Superfamily CBS-domain pair 2.15e-20
Family CBS-domain pair 0.0067
Further Details:      
 
Domain Number 2 Region: 346-433
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 5.18e-19
Family CorC/HlyC domain-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|550990772|ref|YP_008681382.1|
Sequence length 436
Comment hemolysin-like protein [Candidatus Symbiobacter mobilis CR]
Sequence
MEVLLILLLIVLNGLFAMTELALAACRRARLSALAAEGDRGARAALELLDQPDQFLSTIQ
IGITSIGVLNGIIGEAAFSPQFAAWMCSLGTPDAIAHVVATGLVVTIVTFLTIVCGELVP
KRIGQLYPETVSRWMSQPMQWLARIARPFVSLLAQSTAAMLRLLRIDTQATHSMTEAEIS
ASLEEGLDAGVIEAQEHQMMHNVLALDDRPLTSMMVPRSEVDWLDADATVEAALARLRDD
AGGSTHSWYPVCRGSLDEVLGKISVARLLELGAEAPGTLAKYASEVAFVPETLSGMELLE
QLRLEAGRMVLVVDEYGVVQGLLTPHDLLEAITGELQPASCADAWAVEREDGSWLLDGVM
PVAELKSRLGIDELPLEQRHRYHTLAGFLMATSGHLLATGETVRCGAWQFEVVDLDGRRV
DKVLASRLPTEDAPPS
Download sequence
Identical sequences U5NAQ2
WP_022772125.1.16511 gi|550990772|ref|YP_008681382.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]