SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|239814830|ref|YP_002943740.1| from Variovorax paradoxus S110

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|239814830|ref|YP_002943740.1|
Domain Number 1 Region: 8-143
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.000000000000105
Family Rob transcription factor, C-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|239814830|ref|YP_002943740.1|
Sequence length 155
Comment transcription activator effector binding [Variovorax paradoxus S110]
Sequence
MQKNPPMEPIRRHHGAFRVAGLTVRTTNREENDPATARIGALWNRFFGEETYRSTPGRTG
DARIYGVYSGYESDAHGAFDLTVGVAVADAAGSVAIDAGNYLVFTGQGEMPQMVIAAWQR
IWQYFEAHPEIVRRYRSDFEAYEGPDKVAIHIGVS
Download sequence
Identical sequences C5CUP6
gi|239814830|ref|YP_002943740.1| WP_012746962.1.44240 543728.Vapar_1824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]