SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|239813676|ref|YP_002942586.1| from Variovorax paradoxus S110

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|239813676|ref|YP_002942586.1|
Domain Number 1 Region: 440-579
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.57e-32
Family Flavohemoglobin, C-terminal domain 0.0027
Further Details:      
 
Domain Number 2 Region: 335-434
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 6.63e-22
Family Ferredoxin reductase FAD-binding domain-like 0.0014
Further Details:      
 
Domain Number 3 Region: 568-655
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 0.000000000000157
Family 2Fe-2S ferredoxin-related 0.027
Further Details:      
 
Domain Number 4 Region: 176-293
Classification Level Classification E-value
Superfamily FMN-binding split barrel 0.00000000604
Family PNP-oxidase like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|239813676|ref|YP_002942586.1|
Sequence length 668
Comment oxidoreductase FAD/NAD(P)-binding domain-containing protein [Variovorax paradoxus S110]
Sequence
MKTEFKAPVDSPWHAGELAIQESAGAVRAMDLPGRLYVRNFLLDQHRTFYPLLHFVVLGT
VDPQGNVWATVRAGEPGFLQSPDPATLVVRAPRDTGDPAENGMEDGEAVGVLGIDLITRR
RNRMNGNLRHSDAGTLDIEVAQSFGNCPRYIQNREFSFARDPALPSNKPAVHLDALDARA
YELIEGADTFYVASYVDGQDGMRQVDVSHRGGKPGFVRIGSDGMLTIPDFSGNQFFMTLG
NLLLNPTAGLLFIDSNTGDVLQMTGDAKVILDDPEIAAFEGAERLWTFTPRRVVHRPEGL
PLRWSMTVDGWSPNLRMTGSWEDADRRLAAKALAQRWRPFRVTRLEQECSSVRSIYLSPK
DGVATVLPQPGQHLPIRTMLLDTAEVLVRTYTLSLAPSDGEYRISVKKDGKASRHLHSLR
VGDVLEARAPAGIFTVDAAQRRPLVLLAAGIGITPILAMLRHLVHGGKRTRILRPTWLFQ
SARTLEERPFDAELASLVEAGNGDVRWLRTLSQPGAAVLGRDYDKEGRIDIELLKATLPF
GDYDFYLCGPPGFMQATYDGLRDLDVADDRIRAETFGPSSLKRSSDASTRAVEAPELAAQ
ATDSVRVVFTESGKEGRWTPEDGSLLNVAEALGLAPPFGCRGGSCGTCRTRVLKVSVASR
PSGETTRA
Download sequence
Identical sequences C5CLC5
WP_012745820.1.44240 gi|239813676|ref|YP_002942586.1| 543728.Vapar_0662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]