SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|239813718|ref|YP_002942628.1| from Variovorax paradoxus S110

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|239813718|ref|YP_002942628.1|
Domain Number 1 Region: 417-436,475-724
Classification Level Classification E-value
Superfamily HAD-like 1.54e-53
Family Meta-cation ATPase, catalytic domain P 0.00053
Further Details:      
 
Domain Number 2 Region: 220-316
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.11e-24
Family Calcium ATPase, transduction domain A 0.0049
Further Details:      
 
Domain Number 3 Region: 184-219,317-411
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.000000000102
Family Calcium ATPase, transmembrane domain M 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|239813718|ref|YP_002942628.1|
Sequence length 736
Comment heavy metal translocating P-type ATPase [Variovorax paradoxus S110]
Sequence
MNHAHSGAPQHPHHEGHHAPHDHTPVPVPAPAGTIYTCPMHPEIRQDHPGNCPKCGMTLE
PEMPTLDEGEDPELRDFKRRFLWTLPLTLAVAVLAMAGHRLQWFEMATQSWIELVLSLPI
VLWAGWPFFRRAVQSVANRSPNMWTLIGLGTAAAFVYSVVATVAPRVFPESFMSMGRVAV
YFEAAAVIISLTLLGQILELKARSQTSAAIKSLLGLAPKTARRIGANGTEEDVPIAHVHV
GDKLRVRPGEKVPVDGVVVEGASAVDESMLTGEPLPVTKRAGDKLIGATLNTSGALVMQS
EKVGSQTVLASIVQMVAQAQRSRAPMQRMADHVAGYFVMAVIGIAVLTFFAWGFFGPAPS
WTHGLINAVAVLIIACPCALGLATPMSIMVATGKAATQGVLFRDAAAIENFRKVDALIVD
KTGTLTEGKPGFERAVALPGFSEDEVLRLAASLDQGSEHPLAHAIVRAARERGLALAAAD
EFESASGIGVNGSAGGRRLALGNTALMDQLGVPVDALRPQAEALRAEGASVMFLAVDGQP
AGLLAVSDPVKATTAEALAALKASGMRVIMATGDGLTTARAVAARLGIDEVHGEVKPADK
LALVEKLQREGRIVAMAGDGINDAPALAKADVGVAMGTGTDVAMNSAQVTLVKGDLRGIA
QARIVSEKTIANMKQNLGFAFVYNALGVPLAAGVLFPFTGWLLSPMIAALAMSLRSASVI
TNALRLRAEGTGGRPG
Download sequence
Identical sequences C5CLG7
gi|239813718|ref|YP_002942628.1| WP_012745862.1.44240 543728.Vapar_0708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]