SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|255034781|ref|YP_003085402.1| from Dyadobacter fermentans DSM 18053

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|255034781|ref|YP_003085402.1|
Domain Number 1 Region: 396-606
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.55e-29
Family ABC transporter ATPase domain-like 0.00059
Further Details:      
 
Domain Number 2 Region: 124-177
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.00000000222
Family DNA repair protein MutS, domain III 0.0055
Further Details:      
 
Weak hits

Sequence:  gi|255034781|ref|YP_003085402.1|
Domain Number - Region: 29-85,197-232
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00719
Family Glycerol-3-phosphate transporter 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|255034781|ref|YP_003085402.1|
Sequence length 615
Comment DNA mismatch repair protein MutS domain-containing protein [Dyadobacter fermentans DSM 18053]
Sequence
MEETFKEKARQYKVIAESLVPQLNSLSLARLGVFLATGILILFFAANGWVIPVVGTAVAG
AVLFMVILRRYDELSGAKRKAELLKQINEDEILRAQHQLASFPTGDAFLHRDQDYAADLD
IFGHHSLFQLLNRTTTESAARMLAHWLTSPADRQTISERQAAVRELAPLADWRQAFQAAG
MPFETTKSSYNLLLKWIEEPPQFLPARQRLKTTSIALAAAASLALLYFLFYFLFHLQELS
FMHLLPLGISVAVNSVYLRKFRPVAEHIIQSTQANIGILGAYQSLIGVAWAESFTGKKLR
EIRAALFENGKSAASDIGALKKNLEIFQQKGTRNTIGKNAFYGMLNNLWLLDVHLILRTE
GWKSRNSVRIRPWIAAISELEALASLAGFAHANPGYQYPEITTEPYLIDFRSVGHPLLNH
YRRVTNDFTMSGRGATTMITGSNMAGKSTFLRTIGINLVLAFVGAPCCASHARVSLLRVF
TSMRTQDNLEESVSSFYAELRRIERLLELVGQGEPIFFLLDEMFKGTNSQDRFRGGVSLI
RQLSELDAFGIISTHDLDLARLATDIRNFSFNSTIEDGQISFNYRLTPGICTDFNASELM
RRSGIRILPDVLPAS
Download sequence
Identical sequences C6W3D3
471854.Dfer_0988 gi|255034781|ref|YP_003085402.1| WP_015810491.1.10152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]