SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|255035825|ref|YP_003086446.1| from Dyadobacter fermentans DSM 18053

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|255035825|ref|YP_003086446.1|
Domain Number 1 Region: 621-796
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 4.19e-48
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0019
Further Details:      
 
Domain Number 2 Region: 103-297
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.51e-33
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0031
Further Details:      
 
Domain Number 3 Region: 491-629
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.94e-26
Family Duplicated SiR/NiR-like domains 1 and 3 0.016
Further Details:      
 
Domain Number 4 Region: 19-126
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000000317
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|255035825|ref|YP_003086446.1|
Sequence length 823
Comment nitrite reductase (NAD(P)H) large subunit [Dyadobacter fermentans DSM 18053]
Sequence
MVGYKFCEKLLSRKKEGQEFSITVFGEEPRAAYDRVHLSEFFAGKSADDLSMAGVDWYAE
NGIRLFLSDPVVDIDREEKLVRSHHGHIVYYDYLIMAAGSGAFVPSIPGVEKDGVFVYRT
IEDLELIQSYAKKARKGAVLGGGLLGLEAAKALLDLGLEEAHVVEFAPRLMPRQIDDAGS
RMLQSQLESLGLQIHLSKSTQEIKGDDRIEGMQFADNSFLDVDMLVISAGIRPRDEVAKI
AGLETHPRGGIIVNNQLQTSDPFIFAIGECALAHHMIYGLIAPGYEMADVVATMLTGGEK
EFLPYDMSTKLKLIGTDVASFGDPFVEEPACRTIRYENKAKGIYKRINVSSDGKTLLGGI
LVGEAEQYNMLLQTCKNKTILPPDSEDLILGSRGGEEAGAGVMSLPDDALICSCEAVTKG
MICHEVGENGHHTVDALKKCCKAGTGCGGCIPMVKDLISGVMKEKGVYVRNVICEHFDYS
RQELLDLVKMNGLKTYGAVLDHHGKGDGCEVCKPLVVSLLASLWNENILAKDRAVAQDSN
DRYLANIQKGGTYSVVPRIPGGEITPEKLIVIGQVAQKYNLYTKITGGQRIDLFGAHLGD
LPDIWEELIDAGFESGHAYGKSLRTVKSCVGSTWCRFGVQDSVSFAIEVEDRYKGLRSPH
KLKSAVSGCVRECAEAQSKDFGIIATEKGWNLFVCGNGGSKPQHAQLLATDVDKETCLRL
IDRFLMFYIKTADPLTRTATWLNKMEGGMNYLKAVVVDDVLGIAGELERDMQNLIDVYKC
EWREVVESPELRKRFTHFVNTPMKDPSITFADMREQKRATEWA
Download sequence
Identical sequences C6VXD8
gi|255035825|ref|YP_003086446.1| 471854.Dfer_2058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]