SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|255036379|ref|YP_003087000.1| from Dyadobacter fermentans DSM 18053

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|255036379|ref|YP_003087000.1|
Domain Number 1 Region: 124-280
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 4.28e-39
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00053
Further Details:      
 
Domain Number 2 Region: 418-579
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.31e-30
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0011
Further Details:      
 
Domain Number 3 Region: 21-123
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.76e-26
Family Duplicated SiR/NiR-like domains 1 and 3 0.0064
Further Details:      
 
Domain Number 4 Region: 260-284,328-429
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 8.67e-22
Family Duplicated SiR/NiR-like domains 1 and 3 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|255036379|ref|YP_003087000.1|
Sequence length 742
Comment sulfite reductase [Dyadobacter fermentans DSM 18053]
Sequence
MSDLIISDKVSAVAKRDIIDLQQKIGGFYSGETPEEAFRKFRLTRGVYGQRQPGVQMIRI
KLPYGRITADQLVRIADTSDKFATGNLHATTRQDIQLHFVKLSDSPQLWADLEDAGITLK
EACGNTIRNVTASSIAGIDPDEPFDVTPITHSIFSYFLRNPINQDMGRKFKIAVSSSEKD
TALAFIHDVGLIAKMGQNEAGETVRGFKVLIGGGLGAQPFSAQTAFEFLEEEKVIPFIEA
MLRVFDRYGERVRRHKARMKFLLNDLGLEGMMEKVEEERKAVRNKIFQIPEDLFGTNEYE
AINHAPRPSLSEAEILKIAAESIEADKLDIFTKWLRTNTFEQKQKGWYAVQLRVLLGDMN
SDTARSLADVVRQYAADDIRVTVNQGYILRFVKGEDLVALYHELAKLGLAAPGFDSTMDI
TTCPGTDTCNLAISSSYGITRVLEDVMRDEFPEMIYNQDIKIKISGCMNGCGQHNAANIG
FHGSSIKNGKLVLPALQVLLGGGFSGDGIGLIGDKVIKVPTKRGPEVLRLIFNDYEANAL
DGEYFNQYYLRQTKNYFFQLLKPLADLTTVQDDDYRDWDHDELFKTEIGVGECASVLVDL
VATTIIEGQEKLNLAKESFQSDVWADAIYHAYNVFITGAKGLLMSKDVTTNTQYGIINDF
ETHFGADFKYNVPAEFAVENQAETPFKALVFSINKFEPSEAFASYFINTAESFLNFVRET
REAQLIETGEPALQELSFGKDS
Download sequence
Identical sequences C6W2I1
471854.Dfer_2618 gi|255036379|ref|YP_003087000.1| WP_015812085.1.10152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]