SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|255036684|ref|YP_003087305.1| from Dyadobacter fermentans DSM 18053

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|255036684|ref|YP_003087305.1|
Domain Number - Region: 45-104
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000106
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|255036684|ref|YP_003087305.1|
Sequence length 264
Comment protein PASTA domain-containing protein [Dyadobacter fermentans DSM 18053]
Sequence
MAKISTQSRTDLFIHIGIIVSLLLVLFLGFFFVYLPFTTNHGEAITVPDLKKKSVEDLED
FLGDRDLRYEVDCTFVTNVPALTIISQYPLPGSKVKEGRKIYVTVVSRTAPLIKMPKLTD
MTHRSAQMLLKSVGLEEGNISYVPDMAQNAVLKQMYNGKEILPGQPIAKGSKIDLELGEG
LGTAQFEAPSVIGMPVDEAKIAIVGAGLKVGQQMEVPAEEGQAPGSIVRQNPDAGNKVRI
GDVIDLWVTPQAPESTDNENQPQQ
Download sequence
Identical sequences C6W5C2
WP_015812389.1.10152 471854.Dfer_2925 gi|255036684|ref|YP_003087305.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]