SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|255036845|ref|YP_003087466.1| from Dyadobacter fermentans DSM 18053

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|255036845|ref|YP_003087466.1|
Domain Number 1 Region: 41-282,346-377
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.32e-83
Family Type II chitinase 0.00000785
Further Details:      
 
Domain Number 2 Region: 282-345
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.00000194
Family Chitinase insertion domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|255036845|ref|YP_003087466.1|
Sequence length 388
Comment glycoside hydrolase [Dyadobacter fermentans DSM 18053]
Sequence
MRLFPTQKSLGTALLLVFLLAPLLFLNGCSSDKDGEGDADSTKRPVVIGYVGGFHGLLNT
SNIDAKMLTHINYAFVDIKNGKAFLTNEKTDTTNFRQLNLLKGDNPDLKIMISIGGWAWS
ENFSDAVLTDSARKVFAKSSVDIIKKYNLDGVDIDWEYPGLPGEEGNVFRPEDKQNYTEM
FHAIRNELDLLEKETGKKKLLTTAVAGWVEFLKATEMDKAQRYLDYVNLMTYDLFQGDTA
VHHASLYPSNIYKTAKSVDNAVKGFHAAGVPMEKLVVGLPFYGRMFTVAKLDKGLGQKQI
KQQYVDGYSYIKDSLVNKKGFKEYRDTVAKAPYLLNAETGDVLSYDDEESVREKCKYVLT
NKLGGVMFWEYDSDPKKYLLNEIDKSLK
Download sequence
Identical sequences C6W6G1
gi|255036845|ref|YP_003087466.1| WP_015812549.1.10152 471854.Dfer_3086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]