SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|255037273|ref|YP_003087894.1| from Dyadobacter fermentans DSM 18053

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|255037273|ref|YP_003087894.1|
Domain Number 1 Region: 200-594
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.73e-79
Family beta-Lactamase/D-ala carboxypeptidase 0.0013
Further Details:      
 
Domain Number 2 Region: 62-247
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 1.31e-19
Family Penicillin binding protein dimerisation domain 0.007
Further Details:      
 
Domain Number 3 Region: 662-713
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000000222
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|255037273|ref|YP_003087894.1|
Sequence length 714
Comment peptidoglycan glycosyltransferase [Dyadobacter fermentans DSM 18053]
Sequence
MKNEVESGQNNKKALINRARLVGWLLFVLAIMVFVKLIRVQYYDTFKGKTWAEYSEKNDL
KLDTIPAMRGNIYASDNSLLATSLPYYYVGFDTKVADSAYFYNHIDELAALLAKNFKENS
AEGYKSKIMRYRVSKSKRYLRLKSREITHLERERLKKWPFFAKDRKGGGGKFETIYKRYK
PFSPMADRTIGGIDPKSGRGYIGLEASFDKQLEGRPGIGWVEKVEGGLKIPVGDAFNVQP
EAGRDIYTTLDMNYQERTEIALRRKLLEMDADFGSVIIMEVATGEIKAMANLTKRGPGKY
EEVFNYALAGSNDPGSTFKLATMMALLEETNMDPDQVMVNTGNGAMKFRNHTIRDAHRGG
FGTITASQVLEKSSNIGIVQLMQRYFANKPDKYLGYLKQFHLTQPTGIHMKGEKPPLIRD
RKSKQWSSYSMYFMAHGYEMQMTPLQTLAFYNAVANNGYWVRPMIVREIRNAEEIEDKIP
PYVEEKPIASPETIRKVKKMLEGVVNAGLAKTIKSDLYQIAGKTGTARKLINGIYTEGKN
YTSFAGYFPAEKPKYSCIVIIDNPKSSGADYTRYAGSVAAPVFKEVADRIYAYDVAIQKP
VKDSIPEKSEDVKWAGTISDLNAISKTLNMTPAPADSEYATASLYKKGKTKWNPREVDSR
DVPDLQGMSMRDALYLMENKGFRVTFRGSGKVIEQSLPPGTNKSGSKTILLTLQ
Download sequence
Identical sequences C6VTW1
WP_015812973.1.10152 gi|255037273|ref|YP_003087894.1| 471854.Dfer_3521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]