SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|255037567|ref|YP_003088188.1| from Dyadobacter fermentans DSM 18053

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|255037567|ref|YP_003088188.1|
Domain Number 1 Region: 230-436
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5e-31
Family ABC transporter ATPase domain-like 0.00063
Further Details:      
 
Domain Number 2 Region: 5-161
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.0000955
Family DNA repair protein MutS, domain III 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|255037567|ref|YP_003088188.1|
Sequence length 445
Comment DNA mismatch repair protein MutS domain-containing protein [Dyadobacter fermentans DSM 18053]
Sequence
MQPVDRHTLHELQILPENSRTASILAFYNHTETLGGADYLKNIITKPKETLEDTIRFQDL
LKTFANHPAAWRINIAKAYAAAAESYFALSVAHSMSQDAIKHWFDTWWYSKRNKAEYYRI
QSGVLATLRVLRAVQSTLDHISETAIPDEIADDISELRKFVSSPALSLLLGKKDHKISNR
ITFYLDYHFRISHRNGFRHMLDTLYKLDACLAIVKAARAYELTFPVFECDSNDFSAGDAW
HPLIEEAVPNDLKPGNPVCILTGANTSGKTTFLKTCGIIVYLAHLGWPVPAKSLHLPFID
RLFTSIHLSDDLDQGFSHFYNEMMRIKQISEALSAGEKCFVIVDELFRGTNQEDALHCSK
TVLDGFANFYGSRFLVSTHLHELITHYADHPRLSFRCFRTRITDNQFENTFKIEEGTAFE
KVGRLIMEQTGVTALLHNAKRPSSE
Download sequence
Identical sequences C6VWJ2
gi|255037567|ref|YP_003088188.1| WP_015813267.1.10152 471854.Dfer_3819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]