SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|255037879|ref|YP_003088500.1| from Dyadobacter fermentans DSM 18053

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|255037879|ref|YP_003088500.1|
Domain Number 1 Region: 383-598
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4e-31
Family ABC transporter ATPase domain-like 0.00041
Further Details:      
 
Domain Number 2 Region: 133-185
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.00000000523
Family DNA repair protein MutS, domain III 0.0054
Further Details:      
 
Weak hits

Sequence:  gi|255037879|ref|YP_003088500.1|
Domain Number - Region: 12-75
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 0.00249
Family Multidrug efflux transporter AcrB transmembrane domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|255037879|ref|YP_003088500.1|
Sequence length 610
Comment DNA mismatch repair protein MutS domain-containing protein [Dyadobacter fermentans DSM 18053]
Sequence
MKNTEITSSASRQFFQAEKEKATTAEQAANERFKRIALLRLATFAGMVLLAVVWNKTGVA
YWGIGILVLLVIFLVLMGKQQQARIGRNFQRNLVTINDDELARLDFRFKRPDTGAGFREK
DHHYADDLDIFGEYSLFKLLNRTRTAEGSRRLANWLKNPATPPEIALRQAAATDFSRHPG
LMQQWEATALLHEHAASHVGEFQTWVVEMFPAPLQAALKWRWFPLVTLAIMVLYFAGIVP
GYAVFASLAVHLFILGRYTEFVKVLANRTTSMGQTLTAYSELLKKAEDAPYQSAWWQSRK
ARITGSSAALAKVGNLFEKLDYRNNPYFAIFVGIPTLWDMHCLAGLEAWKAEHHSHLNHW
LDVLADTEAMNSVAGHAFANPHYIVPQVSDTAEVTISAADLGHPLIPGAKRISNDFAMQG
TGKTILVTGSNMSGKSTFLRTIGLNLVLAQMGAVVSAGALACSPVRVFSSMRTQDSLEES
TSSFYAELKRLRKLLELADEQANAPVFYLLDEILKGTNSADRHRGAEALIRQLHTKKASG
MVSTHDLELGEWGATETYIHNFHFRSDVENGQLHFDYRLHDGICRSFNASELMRMMGIAI
GPDESPLVHS
Download sequence
Identical sequences C6W008
gi|255037879|ref|YP_003088500.1| WP_015813578.1.10152 471854.Dfer_4132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]