SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|255038804|ref|YP_003089425.1| from Dyadobacter fermentans DSM 18053

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|255038804|ref|YP_003089425.1|
Domain Number 1 Region: 295-522
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.4e-38
Family ABC transporter ATPase domain-like 0.00012
Further Details:      
 
Domain Number 2 Region: 72-290
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 1.7e-17
Family DNA repair protein MutS, domain III 0.017
Further Details:      
 
Domain Number 3 Region: 726-802
Classification Level Classification E-value
Superfamily SMR domain-like 0.0000000314
Family Smr domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|255038804|ref|YP_003089425.1|
Sequence length 802
Comment MutS2 family protein [Dyadobacter fermentans DSM 18053]
Sequence
MLYPNTLEQKLGFDKLRERLKELCISSLGQGFVEKIRFSENFGMVEKLVSQTAEMQRILE
LGENFPSQNYIDATPYLKRASIEGMLLTQPEFSDLKVSLLTIRLCLRFFESQEADAFPIL
GEYAKTIRVEKAVTDAIDRIIDDRGQIRDSASSELSRIRKRLISEQAGIRKKLDTILKSA
RSNGWIGDDVSLTVRNGRMVIPVAAEHKRKLRGFIHDESATGQTVFIEPTDVFESNNEIR
ELEYEERREMNRILHELTAYIRPFVPDLQKAYGFLGLMDFLRAKARLAGEMGAINPPFEN
RQFIDWREARHPLLHLSFQKQGKKVIPLNIELQEKQRILIVSGPNAGGKSVALKTVGLIQ
YMFQCGLLVPMLEGSSMGFFQNIFIDIGDEQSLENDLSTYSSHLTNMRHFLSMANKRTLF
LIDEFGTGTEPGLGGAIAEAILENLTKSGAFGMINTHYTNLKVLADKTEGLVNGAMRFDG
EHLEPLYQLEIGRPGSSFAFEIASKIGLPKAVVARAKEKLGTQQVNFEKLLKELDIERRV
FAEKNIEIGIKERKLTKQVADYTALKEKLENNEKKIVNEAKQKAKNLLSDANQLIENTIR
EIKENKAEKEKTKTVRTTLENFGKNNLKLAEVTESQPAEEEYEPEGGDITPGSYVRISGQ
TAIGEVLSVKGKDAEIRIGDLKSNVKLNRLEKVSRKTYRAATGDKGIKAAYRGVDMNERM
LNFSFNLDMRGKRGEEALGLVDQFMDNAIMLGYDELRIVHGKGDGILRTLVRNHLRGYKQ
VAGMYDEHADRGGAGVTIVKLK
Download sequence
Identical sequences C6W7R6
WP_015814501.1.10152 471854.Dfer_5060 gi|255038804|ref|YP_003089425.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]