SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|255035690|ref|YP_003086311.1| from Dyadobacter fermentans DSM 18053

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|255035690|ref|YP_003086311.1|
Domain Number 1 Region: 109-244
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 3.27e-31
Family Flavohemoglobin, C-terminal domain 0.00054
Further Details:      
 
Domain Number 2 Region: 3-108
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 3.06e-28
Family Ferredoxin reductase FAD-binding domain-like 0.00031
Further Details:      
 
Domain Number 3 Region: 269-353
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.52e-16
Family 2Fe-2S ferredoxin-related 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|255035690|ref|YP_003086311.1|
Sequence length 353
Comment oxidoreductase FAD-binding domain-containing protein [Dyadobacter fermentans DSM 18053]
Sequence
MFKPVQVIDKVQESQTIWSFYLKPADGDRLAHYLPGQHIIVRLQIPGQAGPVQRSYTLSG
VPGQNLYRITVKREGTPDQPGIASSFLHDHVDIGDTIWISEPLGGFALQKDSRRPVVLLS
AGVGITPMLSMLEAIAEEPDPRQVWFVHGSRNAGEQPMLAWLRSLARTQAHIRVSIHHSQ
PSPFEIIRVDYDALGRIHLDFLKQNSSPTHSDFYICGPASFVKTLADGLRSLGIADSRLS
CTYFSGNDNTVLPDQQTAPIFIEEDLAGAVPTISLTQSGRLFSWADGDGNLLNLLEKHDI
YPPSSCTEGTCMSCSTRMISGTVTYDPEPFGDPFEGEILLCCARPETDITLDL
Download sequence
Identical sequences C6VW14
471854.Dfer_1915 WP_015811399.1.10152 gi|255035690|ref|YP_003086311.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]