SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|255036293|ref|YP_003086914.1| from Dyadobacter fermentans DSM 18053

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|255036293|ref|YP_003086914.1|
Domain Number 1 Region: 130-206
Classification Level Classification E-value
Superfamily E set domains 0.000000331
Family E-set domains of sugar-utilizing enzymes 0.02
Further Details:      
 
Weak hits

Sequence:  gi|255036293|ref|YP_003086914.1|
Domain Number - Region: 60-119
Classification Level Classification E-value
Superfamily E set domains 0.000675
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.085
Further Details:      
 
Domain Number - Region: 285-342
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0108
Family CBM11 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|255036293|ref|YP_003086914.1|
Sequence length 384
Comment hypothetical protein Dfer_2531 [Dyadobacter fermentans DSM 18053]
Sequence
MSKTFIFGIIYRAICVLIGVLAVSCQKDDLPNGGEPVIKFIRVTDPESADSLLTSAGQDK
LIAIVGENLHDAREIWFNDQRASLTPSYITATTILVTVPGHIPGEISNKLRIVFGNGKIV
EHDFEVKISEPLVTSMVCEYVPAGSIATIHGDFFYEPLTVSFAGGKPGAVVAVKDQEIQV
TVPEGAQPGPITVKTKFGETKSDLWFRDNRNIFISSDPFTGWWNASFVVSKPGPGDPSAI
NGNYIHVKKPIGGWQWTEVAGGPPDAMGAISKNIPDSAILKPADYVLKFEVNTVKPYNNN
VLKITAGLAAGFNDSQYTWLPPYDTKGQWQTVTIPFQEIAASYESAGSKLVVSEKGYYTR
LLFHGGGDLDCDMAFDNFRVVQRR
Download sequence
Identical sequences C6W1L9
471854.Dfer_2531 gi|255036293|ref|YP_003086914.1| WP_015811999.1.10152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]