SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|255038625|ref|YP_003089246.1| from Dyadobacter fermentans DSM 18053

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|255038625|ref|YP_003089246.1|
Domain Number 1 Region: 95-241
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 6.81e-30
Family Reductases 0.035
Further Details:      
 
Domain Number 2 Region: 238-346
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 9.57e-27
Family 2Fe-2S ferredoxin-related 0.0092
Further Details:      
 
Domain Number 3 Region: 6-107
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.43e-23
Family Ferredoxin reductase FAD-binding domain-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|255038625|ref|YP_003089246.1|
Sequence length 350
Comment ferredoxin [Dyadobacter fermentans DSM 18053]
Sequence
MADHTIALKLREIIRETDDAKTFVFETLDGSTLHYKAGQFLTFLINMHGHEVRRSYSMSS
APGVDEFPAITVKRVPNGEISRFWIDLVQAGDTFRVLAPSGRFVLEEDDAGERDIVLIGA
GSGITPLFSLLKQTLTQETDSHVTLIYASRNVRSTLFWNHIIEWQARFPERLHVVHIHSQ
PTEEWAGIQGRINNTRLEQLVAKSIRYRREDARFFICGPFELMRSAGITLHFMGFHGTQI
RKENFVITSPPPPPPVSHPHHITLRYDGNVHNLLVPAHATVLDAALAQGIQLPYSCKGGR
CSSCAAVCTQGTVHMSVNEVLTDRDLAEGWILTCSAYVDSDNVVVEFRQQ
Download sequence
Identical sequences C6W6M0
gi|255038625|ref|YP_003089246.1| WP_015814322.1.10152 471854.Dfer_4880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]