SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|255039304|ref|YP_003089925.1| from Dyadobacter fermentans DSM 18053

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|255039304|ref|YP_003089925.1|
Domain Number 1 Region: 13-197
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.02e-57
Family Methylesterase CheB, C-terminal domain 0.0001
Further Details:      
 
Weak hits

Sequence:  gi|255039304|ref|YP_003089925.1|
Domain Number - Region: 239-268
Classification Level Classification E-value
Superfamily YfgJ-like 0.0183
Family YfgJ-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|255039304|ref|YP_003089925.1|
Sequence length 351
Comment CheB methylesterase [Dyadobacter fermentans DSM 18053]
Sequence
MGSNQPQKVMAKRNIVVIGASLGGLEAFKKLVSGLPADIGASIFLVWHISPNAEGVLPGV
LGELTDLTVVHADHGDLIRPNRIYVARPDHHLLVDDRHVHVTRGPKENRFRPAIDPLFRS
AAYAFGSRVIGIVLSGALDDGTAGLWSIKRCGGIAIAQDPDDAEMPSMPKNAIREVAIDY
IVPVSEMAALLVKLCNETVEIGTRLDKEELGQLEAEVRVAADQNRLDIDIPQYGEMSKLS
CPECQGVLTLLKDGSLSRYRCHTGHAFSPETLLEAIAEKIESNLFAALRGVDEHVILLNH
MGDHFAEANYRADAARYFRKAREAEQRVALIRNAIRASADIEVIRTSEERL
Download sequence
Identical sequences C6VVN0
471854.Dfer_5570 gi|255039304|ref|YP_003089925.1| WP_015815000.1.10152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]