SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226309708|ref|YP_002769602.1| from Brevibacillus brevis NBRC 100599

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226309708|ref|YP_002769602.1|
Domain Number 1 Region: 9-239
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.26e-56
Family PP-loop ATPase 0.00013
Further Details:      
 
Domain Number 2 Region: 376-460
Classification Level Classification E-value
Superfamily PheT/TilS domain 2.62e-19
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.0078
Further Details:      
 
Domain Number 3 Region: 222-326
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.0000000000228
Family MesJ substrate recognition domain-like 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|226309708|ref|YP_002769602.1|
Sequence length 475
Comment tRNA(Ile)-lysidine synthetase [Brevibacillus brevis NBRC 100599]
Sequence
MLASVRNEIEAEGLLLPGESVVVGISGGNDSTALLHILASLNKQYQYQWKLHAVHLNHGF
RGEEARQDALYAEELCRELGVVFHLFEYDVPAYMEKTGLGGQEASRDIRYRLYREVGLAQ
GATKLALAHHADDQVETILFRFVRGSRLNGLTGMPKRRMLADCPIELVRPLLHKTRQELE
GYCREHQLVPREDSSNQSRKYTRNLLRLDVMPLLEKVNDKYREHILATAEAIRQDEALLM
RLANEQLKKVMIEKKPEAFLMDNDKFQTCDVALQRRMITLILSYLSKHTEWSSQHVETVL
HMLGGSRPSAELHLPNDLVVDRVYERITFRRRKRQDRIHTYSYELAVPGVTWIDESKATV
HITYLEGPMDWERLSANEAVFDADQLPGSLYLRNRKPGDRITLFGSANGKKLKELLIDAK
FPRAWRDKLPLLTAGDEVILVPGVRRSAVAPINGQTRRFLHVRVEFGEDWREVFS
Download sequence
Identical sequences C0ZHF7
gi|226309708|ref|YP_002769602.1| WP_012683891.1.45054 358681.BBR47_01210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]