SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226310206|ref|YP_002770100.1| from Brevibacillus brevis NBRC 100599

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226310206|ref|YP_002770100.1|
Domain Number 1 Region: 137-445
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 7.32e-61
Family DmpA-like 0.0027
Further Details:      
 
Domain Number 2 Region: 19-118
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 0.00000000206
Family FAD-linked oxidases, N-terminal domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|226310206|ref|YP_002770100.1|
Sequence length 450
Comment hypothetical protein BBR47_06190 [Brevibacillus brevis NBRC 100599]
Sequence
MGGEKRSSRKASTHSSVRKKASPKLTGRIVLPGNAPYHGRRGCFNSFPKVIVYAQKKQDI
VNAVRWARHHHVPVRYRRPGHPYDKRVPNYKGAMVIDISEMHRREMVNKGSRRILTQPIG
PSPDRLIGQKRSILEGGLTDVPGILVGHAEDESGRTGCTVILCPSGAVPGVDVRGGFPGT
IQTDAIRPGTATDVVQGVLLTGGSNFGLAAASGVMNWLAQNGIGAPTEAGPLPTVPGAVI
FDLIYAKGARRPDAEMGYIASEEANSGPVEEGSVGAGAGATVGKIYGTPMKGGVGTASWK
IPGGPVVAALAVVNAVGDIWDQDHIIAGALRPNGTFVNQTRAILEGIPPGTSGSRNTTIA
VVATTGRLTKAEAGRVATLAHDGMARAISPVHIQSDGDTVFCLATGTDTSGLTGDSAVTA
IGTTAAVVLEEAIIRGVKAANSIRPRHGGK
Download sequence
Identical sequences C0ZKE5
gi|226310206|ref|YP_002770100.1| 358681.BBR47_06190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]