SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226310832|ref|YP_002770726.1| from Brevibacillus brevis NBRC 100599

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226310832|ref|YP_002770726.1|
Domain Number 1 Region: 1-257
Classification Level Classification E-value
Superfamily Tetrapyrrole methylase 2.22e-58
Family Tetrapyrrole methylase 0.00043
Further Details:      
 
Domain Number 2 Region: 448-564
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.93e-21
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0039
Further Details:      
 
Weak hits

Sequence:  gi|226310832|ref|YP_002770726.1|
Domain Number - Region: 376-435
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 0.061
Family Duplicated SiR/NiR-like domains 1 and 3 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|226310832|ref|YP_002770726.1|
Sequence length 585
Comment precorrin-3 methylase [Brevibacillus brevis NBRC 100599]
Sequence
MSGKLFVIGFGPGSFEHITKRAREALQESDVIIGYSTYVDLIRGLLTNQQIVSTGMTEEV
ARAREAVRQAEEEGKKVAVISSGDSGVYGMAGLVYEVLVEKGWTEATGVPIEIVPGISAI
NSCGAILGAPIMHDACTISLSDHLTPWELIAKRIDAAGMADFVIALYNPRSGRRTRQIVE
AQRILLQYRSPDTPVGIVKSAYRERETVVVTTLAQMLEHDIGMLTTVIIGNTSTFVYDGK
MITPRGYQRKYTLSADEQPLKPHQRLRVENEPWSLEASEESLASAPATPATPNTERPVAV
TEDRVPATEPANRVATSTAVLEAPPVTEEAAPKAPFAWAMEALTAINAAKGIETKPAVGQ
VNRPVSTFTPEMIFECAVSPGVANKKITPLQMMAIAEVAGEKGEIEYTPHHQMILRVPTA
NPESITSHLRELGLILSPIGDVLQVKACDFCDGEKKDSIPYAEELHQKLGGKEMPKELKI
GFNGCGMACYGAVQEDIGIVFRKGKFDLFLGAKTVGRNAHSGIPVAEGIEKEEIVPLVER
IVNRFKKDAFPNERFHKFFQRVGELEGFAWYEPAKAEIENAACGD
Download sequence
Identical sequences C0Z7H9
WP_012684973.1.45054 gi|226310832|ref|YP_002770726.1| 358681.BBR47_12450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]