SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226311228|ref|YP_002771122.1| from Brevibacillus brevis NBRC 100599

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226311228|ref|YP_002771122.1|
Domain Number 1 Region: 208-399
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.52e-65
Family B3/B4 domain of PheRS, PheT 0.00000682
Further Details:      
 
Domain Number 2 Region: 473-700
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.72e-52
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00014
Further Details:      
 
Domain Number 3 Region: 39-199
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.65e-49
Family Myf domain 0.0024
Further Details:      
 
Domain Number 4 Region: 709-806
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.07e-30
Family Anticodon-binding domain of PheRS 0.00018
Further Details:      
 
Domain Number 5 Region: 410-481
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 2.2e-19
Family Domains B1 and B5 of PheRS-beta, PheT 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|226311228|ref|YP_002771122.1|
Sequence length 807
Comment phenylalanyl-tRNA synthetase subunit beta [Brevibacillus brevis NBRC 100599]
Sequence
MKVSYQWLSEYVDLSGTTPQELAEKLTRSGIEVDAVESRNEGVSGVVIGYVKERSKHPDA
DRLNVCVVDAGQGEDLQIVCGAANVDQGQKVLVALIGAKLPGGLNIKRSKLRGVESQGMI
CSAKELGLNDKLLAKDQQEGIMVLPADAEIGMDAVSYLGLDDYVLELGLTPNRSDCLSML
GVAYEVAAILGKEVVFPQIELTENGGDNPIQVKIDATNECYQYHGRHFTNAKIATSPQWM
KNRLMAAGIRPINNVVDVTNYVLLEYGQPLHAFDATQVADRSIVVRLANEGEKLVTLDDQ
ERALDAQTLLIADQTKGLAIAGVMGGANSEITGETSEIILEAAWFTPKTVRRTARMLGMR
TEGCVRWEKGVDQARVQEAGERAAALIQQLSGATVSKGISSAVVSEAAPAVVSVTLAKIN
QHLGTDMSASDVSPIFERLQFPYEVAGDKWTVTVPTRRGDITLPEDLVEEVARLYGYDNI
PTSLPSGSTTQGQLTKEQQLRRTIRHHLIGTGMNEAISYALVHPDRVEAVAGLHQEKVNP
VALMMPMSEDHSVLRTSLIPSLLETVAYNKNRQNHDVAIFELGRVFLTKEETLTQLPEER
LYVAGALTGQLLTQNWMGAKQPVDFFQTKGIVESLFARLGIQATEYKAVQDIAGMHPGRT
AEVWVGEKRLGYLGQVHPGTEKAYDLSETYVFQLDVAVLIDVAAEVGHYNQLPKSPAVTR
DLALVVDRNVAAGALEATIREAAGELLESVTLFDVYMGERIAQDKKSMAFALVFRHAERT
LQDEEIQQVTTAVIEALKNNTGAELRV
Download sequence
Identical sequences C0Z9E8
gi|226311228|ref|YP_002771122.1| 358681.BBR47_16410 WP_012685365.1.45054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]