SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226312963|ref|YP_002772857.1| from Brevibacillus brevis NBRC 100599

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226312963|ref|YP_002772857.1|
Domain Number 1 Region: 253-553
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 1.31e-91
Family DNA repair protein MutS, domain III 0.00000141
Further Details:      
 
Domain Number 2 Region: 555-787
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.78e-61
Family ABC transporter ATPase domain-like 0.000000751
Further Details:      
 
Domain Number 3 Region: 2-112
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 8.89e-43
Family DNA repair protein MutS, domain I 0.0000233
Further Details:      
 
Domain Number 4 Region: 114-266
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 6.54e-29
Family DNA repair protein MutS, domain II 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|226312963|ref|YP_002772857.1|
Sequence length 862
Comment DNA mismatch repair protein MutS [Brevibacillus brevis NBRC 100599]
Sequence
MAQYTPMIQQYLAIKKDYPDTFLFFRLGDFYELFFDDAILASRELEITLTGRDGGGSERI
PMCGVPHHAADGYIAELLKKGHKVAVCEQVEDPKEAKGVVRREVTRVITPGTMMEGKWLT
DKENNYMAALAQVEGRTGVAACDMSTGEMYVTSLAGQAESVLDEALQYRPKELVFFGLAA
LPKTALPSTVVDAHQLDVFAVDSQYAEQAKGLDVSMRAAVNALLFYIGTTQKRSLAHMRL
LKQYDAKQYLQMDGFSRRNLELTETIRDKTKKGSLLWLLDRTQTAMGGRLLRRWIERPLL
SRDQLEARLSAVEALKGDMLLRSDLRTCLDRVYDLERLAGRISYGNANARDLIQLRMSLE
AVPELKQYMIQTNTPVLMELANGMDECADIVNYLAHALVDDPPISVREGGMIRTGYDEYL
DKLHTASREGKTWIAQLEQGEREATGIRSLKVGFNKVFGYYIEISKSNIANVPAGRYERK
QTLANAERYITPELKEREALILEAEEKMIELEYQLFVAVRSEVAKHIPRLQNLAERIASV
DVLQAFATVSDERGFVRPELVESGDYVITEGRHPVVEAVLEREKYVANDVEMDQTNRQVL
LITGPNMAGKSTYMRQIALITVMAQIGCFVPAKQAKLSIVDQIFTRIGAADDLVGGHSTF
MVEMLETRHALQKATAKSLILLDEIGRGTSTYDGMALAQAVIEYICQKIGAKTLFSTHYH
ELTGLAETLSGVVNVNARCEEREGKLLFLHKIEEGRADKSYGIHVAELAEMPTWVIERAR
SILTGLEANGSTGNGNAASDVQMSLETLWTAPVAAVREEPMQFASAEEEAIMAELRELDL
NSTTPMDAMMKLYAWKQQLKKR
Download sequence
Identical sequences C0ZEZ4
WP_015891660.1.45054 358681.BBR47_33760 gi|226312963|ref|YP_002772857.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]