SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226315434|ref|YP_002775330.1| from Brevibacillus brevis NBRC 100599

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226315434|ref|YP_002775330.1|
Domain Number 1 Region: 147-346
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.83e-60
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.000000573
Further Details:      
 
Domain Number 2 Region: 431-563
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 8.64e-37
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000565
Further Details:      
 
Domain Number 3 Region: 12-146
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.64e-33
Family Duplicated SiR/NiR-like domains 1 and 3 0.0038
Further Details:      
 
Domain Number 4 Region: 348-424
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 8.18e-22
Family Duplicated SiR/NiR-like domains 1 and 3 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|226315434|ref|YP_002775330.1|
Sequence length 573
Comment sulfite reductase subunit beta [Brevibacillus brevis NBRC 100599]
Sequence
MSENHLLSSNSAPHSDVEDIKRKSDYLRGSLAETLEDRISGSIPEDDNRLMKFHGSYMQD
DRDLRNERSKQKLEPAYQFMVRVRAAGGVVTPEQWLMMDDIAQQFANGTIRLTTRQSFQL
HGVIKWNMKQVIQEVNEALLSTLAACGDVNRNVMCNPNPYESEVHQEVYEWAKKISNHLD
PRTRAYHEIWLDEEKVVDSRDEVEQEPIYGPVYLPRKFKIGIAVPPANDVDVFSQDLGFI
AIHEEGRLLGFNVAVGGGMGMTHGDPKTYPQVARVIGFVTPEQVLEVAEKTVMIQRDYGD
RAVRKHARFKYTIDDRGIEWFIHELEQRLGWELEQVRPYHFEHNGDRYGWVKGSDDNWHF
TLFIQNGRVKDEDNYLLKSGLREIAKVHTGDFRLTPNQNLLIGNVTSEKKPEIEQIIQAY
GLTDGATYSALRRNSMACVSLPTCGLAMAEAERYLPTLLDEIELILDEAGLRDEEIVIRM
TGCPNGCARPALAEISFIGKAVGKYNMYLGGGFSGNRLNKLYRENIGEAEILNELRPILN
RYAKEREEGEHFGDFVIRAGYVKEVRSGLDFHE
Download sequence
Identical sequences C0Z9X2
WP_015894010.1.45054 gi|226315434|ref|YP_002775330.1| 358681.BBR47_58490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]