SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256824641|ref|YP_003148601.1| from Kytococcus sedentarius DSM 20547

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256824641|ref|YP_003148601.1|
Domain Number 1 Region: 13-209
Classification Level Classification E-value
Superfamily Formyltransferase 1.31e-52
Family Formyltransferase 0.0000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256824641|ref|YP_003148601.1|
Sequence length 209
Comment phosphoribosylglycinamide formyltransferase, formyltetrahydrofolate-dependent [Kytococcus sedentarius DSM 20547]
Sequence
MTQVQLGPTSHRLRVVVLLSGAGSTARAVLDAADGTAPFEVVAVVADRPAEGLDHAATRG
LPTALVAPADHADRAAWDAALAQVVAVHRPDLVLSAGFMRLLGPAFLERWGGLTLNCHPA
LLPSFPGAHGVRDALEHGVAVTGCTLHLVDAGTDTGPILDQRAVRVEPGDDEATLHERIK
VAERELLVTTLTRIATGGVTLHDRKATWA
Download sequence
Identical sequences C7NF12
WP_012802251.1.81216 gi|256824641|ref|YP_003148601.1| 478801.Ksed_07800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]