SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256825114|ref|YP_003149074.1| from Kytococcus sedentarius DSM 20547

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256825114|ref|YP_003149074.1|
Domain Number 1 Region: 4-214
Classification Level Classification E-value
Superfamily Formyltransferase 1.44e-55
Family Formyltransferase 0.00000726
Further Details:      
 
Domain Number 2 Region: 216-329
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 9.03e-21
Family Post formyltransferase domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256825114|ref|YP_003149074.1|
Sequence length 336
Comment methionyl-tRNA formyltransferase [Kytococcus sedentarius DSM 20547]
Sequence
MPLVRIVFAGTPEAALPSLEHLLDSARTADGRDRHEVVGVLTRPDARVGRGRKLRPSPVK
ARALEHGLPVIESDRPWEDEPLASLRELAPDVGAIVAYGALLPTSVLELPTHGWVNLHFS
LLPAWRGAAPAQRALMAGDDLTGATTFVLTEGMDTGPVLGTLTEAIRPTDTAGDLLERLS
EAGAPLLTDSLHGLVSGALAPVPQPADGVSRAPKLTVDEVRLDFTQPAFAVVRRVAGASP
APGAWTTFRGDRLKVLQAAQVAGAPSSTGAGTAGPDDPSTPHLPPGRLLLHDGQVLVGTA
THPVRLQRVQPPGKQAMEAEAWARGARFDDQEALGG
Download sequence
Identical sequences C7NHF2
gi|256825114|ref|YP_003149074.1| 478801.Ksed_12770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]