SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256826256|ref|YP_003150216.1| from Kytococcus sedentarius DSM 20547

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256826256|ref|YP_003150216.1|
Domain Number 1 Region: 6-203
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.02e-52
Family Nucleotide and nucleoside kinases 0.0000997
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256826256|ref|YP_003150216.1|
Sequence length 213
Comment thymidylate kinase [Kytococcus sedentarius DSM 20547]
Sequence
MTVAGHGLFVALEGGDGAGKSTQIRLLVEHLAGQHAGREVVVTREPGGTDLGRRIRELLL
HGDHVAPRAEALLFAADRAHHVESLVRPALDRGAVVVGDRYVDSSIAYQGAGRDLDAVEV
ASISRWATEGLVPDLTVLLDVDPATGRSRRGAEHDRLEAEPTAFHERVRQHFLDLAAAAP
QRYLVLDASRPPQELGAEVARAVDGLLEGVLRA
Download sequence
Identical sequences C7NFU3
WP_015780377.1.81216 gi|256826256|ref|YP_003150216.1| 478801.Ksed_24870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]