SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256825019|ref|YP_003148979.1| from Kytococcus sedentarius DSM 20547

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256825019|ref|YP_003148979.1|
Domain Number 1 Region: 195-343
Classification Level Classification E-value
Superfamily CBS-domain pair 1.39e-32
Family CBS-domain pair 0.002
Further Details:      
 
Domain Number 2 Region: 335-414
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 0.000000000000161
Family CorC/HlyC domain-like 0.0019
Further Details:      
 
Weak hits

Sequence:  gi|256825019|ref|YP_003148979.1|
Domain Number - Region: 4-124
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.000353
Family ABC transporter transmembrane region 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256825019|ref|YP_003148979.1|
Sequence length 495
Comment hypothetical protein Ksed_11750 [Kytococcus sedentarius DSM 20547]
Sequence
MLGWILGAALVLVALTHLMTMAEAALQRISKRHAESLAQEGRPGGDALARILEDTATHMS
VVTFLRVLGECSVAVLLTIAVDRWLDQWWLALLVAVLLVTVVSYVVLGVSPRTLGRQNAE
AIALRAAPVVARARTVLGPLSKALIVVGNAVTPGKGFAEGPFENEAEFRDMVDLAGESSV
IEAEEREMIHSIFELGDTTARRVMVPRTDMVVIEGHKQLRKVMSLALRSGFSRILVVGEG
GTDDILGVVHFKDVVRRVNADPAARESLTAAEVMREATFVPESKNVDQLLREMQVSQTHL
VVVIDEYGGTAGLLTIEDILEEIVGEITDEHDRETAESTQLEDGAWRVAASMDVDHLADL
FEVSFSEEVTEDVETVGGLLAKLVDRVPIVGSTGDVAGIRLTAERLSGRRHRVATVIAEW
IGHGGQVAEHEAAAESAAPAEDEQPEGSGAHAAGPVLDEATAPDMLDQQDDDTPGGLLRL
GAPARQTRPLAKEHP
Download sequence
Identical sequences C7NH44
WP_015779159.1.81216 gi|256825019|ref|YP_003148979.1| 478801.Ksed_11750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]