SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256825630|ref|YP_003149590.1| from Kytococcus sedentarius DSM 20547

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256825630|ref|YP_003149590.1|
Domain Number 1 Region: 3-306
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 6.67e-77
Family ATP synthase (F1-ATPase), gamma subunit 0.0000441
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256825630|ref|YP_003149590.1|
Sequence length 310
Comment ATP synthase F1 subcomplex subunit gamma [Kytococcus sedentarius DSM 20547]
Sequence
MAAGTREYRQRIKSVKATKKITKAMELIAASRVIKARTRVAETSPYARALTKAVSAVATN
SNEDHPLTTEREKRVRAAVVVISSDRGLAGAYPSAPMKFADRLTEQLRDEEGLEVAPYLV
GRKSEGYYRFRNREWVKNWAGFSDAPTVEDAREISDAIIEAFLTPTDEGGVDEVHVVYTR
FVNMVTQEVTAARLLPLEVVDADDETVAGQDQHAATGVDSLTPEYDFEPSADEVLDALLP
QYVSSRIYNMLLQSAASELAARQRAMKSATDNAEDLIKDYTRLANQARQADITQEISEIV
GGSAALADAK
Download sequence
Identical sequences C7NJD8
gi|256825630|ref|YP_003149590.1| 478801.Ksed_18210 WP_015779765.1.81216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]