SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|237785605|ref|YP_002906310.1| from Corynebacterium kroppenstedtii DSM 44385

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|237785605|ref|YP_002906310.1|
Domain Number 1 Region: 116-295,419-588
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.64e-98
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000894
Further Details:      
 
Domain Number 2 Region: 292-414
Classification Level Classification E-value
Superfamily GAD domain-like 8.01e-35
Family GAD domain 0.00062
Further Details:      
 
Domain Number 3 Region: 3-104
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.9e-31
Family Anticodon-binding domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|237785605|ref|YP_002906310.1|
Sequence length 597
Comment aspartyl-tRNA synthetase [Corynebacterium kroppenstedtii DSM 44385]
Sequence
MHRTHLAGELRSHHVGQTVTLSGWVARRRDHGGVIFIDLRDRSGLAQVVFRDSDVAAQAH
HLRSEYCIRVTGVVDARPEGSENPNLDSGAIELNVNELTILNSSEALPFQIDDQSSSGEV
GEETRLKYRYLDLRRKTQHDALVLRSNVNQAARSVLLKHDFHEIETPTLTRSTPEGARDF
LVPARLRPGSFYALPQSPQLFKQLLMVGGMERYFQIARCYRDEDFRADRQPEFTQLDVEM
SFVDQDDVISVAEEILTAIWKEIGYDIPTPIPRMTYADAMKYYGSDKPDLRFDIKIVECT
EFFANTTFRVFQNPYVGAIVMEDGASQPRRQLDAWQDWAKQRGAKGLAYILVGDDGQLSG
PVAKNITDAEREGIADHVGAKPGDCIFFAAGDAKSSRALLGAARGEVARKLGLIKEGDWA
FTWVVDAPLFEPAADATAEGDVALGHSAWTAVHHAFTSPKPECMDSFDKDPGSALSYAYD
IVCNGNEIGGGSIRIHRSDVQQRVFNVMGISDEEAQEKFGFLLEAMKFGAPPHGGIAFGW
DRIVSLLGGFESIRDVIAFPKSGGGVDPLTDAPAPITPEQRKESGIDAKPKKKETKN
Download sequence
Identical sequences C4LIW2
gi|237785605|ref|YP_002906310.1| 645127.ckrop_1014 WP_012731654.1.74818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]