SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|237785902|ref|YP_002906607.1| from Corynebacterium kroppenstedtii DSM 44385

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|237785902|ref|YP_002906607.1|
Domain Number 1 Region: 197-334
Classification Level Classification E-value
Superfamily CBS-domain pair 3.41e-31
Family CBS-domain pair 0.0022
Further Details:      
 
Domain Number 2 Region: 338-416
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 0.0000000000682
Family CorC/HlyC domain-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|237785902|ref|YP_002906607.1|
Sequence length 458
Comment HlyC/CorC family transporter [Corynebacterium kroppenstedtii DSM 44385]
Sequence
MNFLTEGLIDCVIVVVLLAIAAIFTAVETALISISRARVEDMDETRSTRTLLAILDNRAR
FINPLILVRTACEAGASVIITVLAIRLIHEAAVVVAIVLLTLLSYVFLGVVGRTVGRQNP
YTVGLRAAFFLRPIVKLFSPLASLLIWLGNVFTPGKKFEQGPFTNEVELREMVDIASERG
VVQVEERRMIQAIFDLANTRARQVMVPRTDMLWIESEKSARQATRLCVRSGHSRIPVVGE
NVDDIEGVVYLKDLVALSYDDPSKNSTPVKEVMRPAEFVPDSLPLDELLGDMQTSHDHIA
LLVDEFGAIAGLISIEDILEEIVGEISDEYDEDEVAPVEELDDGSFRLVARFSLDELVEL
YDEKRGIDIEFSEEQLEDVETVAGLLAFELGRVPLPGAQVTTAGLTFRAEGGHDRRGRIR
ITSVVVSRSATSSEPVNGDDSSNNGIVHSGTGDHESES
Download sequence
Identical sequences C4LJQ9
645127.ckrop_1320 gi|237785902|ref|YP_002906607.1| WP_012731951.1.74818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]