SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|237786494|ref|YP_002907199.1| from Corynebacterium kroppenstedtii DSM 44385

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|237786494|ref|YP_002907199.1|
Domain Number 1 Region: 401-421,463-711
Classification Level Classification E-value
Superfamily HAD-like 1.07e-54
Family Meta-cation ATPase, catalytic domain P 0.00027
Further Details:      
 
Domain Number 2 Region: 207-304
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 2.75e-25
Family Calcium ATPase, transduction domain A 0.0039
Further Details:      
 
Domain Number 3 Region: 150-208,305-395
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00000000719
Family Calcium ATPase, transmembrane domain M 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|237786494|ref|YP_002907199.1|
Sequence length 744
Comment copper-exporting ATPase [Corynebacterium kroppenstedtii DSM 44385]
Sequence
MSTPHHSGDHHGDHPATETDHTHHPDHASHEHHADPDTHGQAMPHDHPHSALDEDHHVHG
HGEHAGHSTAMFRDRFWWSLILSIPVVIFSPMVAHLLGYHLPAFPGSTWIPPVLGTIIFV
YGGTPFLKGGWKELKSRQPGMMLLIAMAITVAFVASWVTTLGLGGFDLDFWWELALLVTI
MLLGHWLEMRALGAASSALDALAALLPDEAEKVIDGTTRTVAISELVVDDVVLVRAGARV
PADGTILDGAAEFDEAMITGESRPVFRDTGDKVVAGTVATDNTVRIRVEATGGDTALAGI
QRMVADAQESSSRAQALADRAAALLFWFALISALITAVVWTIIGSPDDAVVRTVTVLVIA
CPHALGLAIPLVIAISSERAAKSGVLIKDRMALERMRTIDVVLFDKTGTLTEGAHVVTGV
AAAVGVTEGELLALAAAAEADSEHPVARAIVAAAAAHPEASRRQIRATGFSAASGRGVRA
TVDGAEILVGGPNMLREFNLTTPAELTDTTSAWTGRGAGVLHIVRDGQIIGAVAVEDKIR
PESRAAVKALQDRGVKVAMITGDAQQVAQAVGQDLGIDEVFAEVLPQDKDTKVTQLQDRG
LSVAMVGDGVNDAPALTRADVGIAIGAGTDVAMESAGVVLASDDPRAVLSMIELSQASYR
KMIQNLIWASGYNILAVPLAAGVLASIGFVLSPAVGAILMSASIIVVALNAQLLRRIDLD
PAHLAPTESKEQHTTPTPASTAVH
Download sequence
Identical sequences C4LLF1
645127.ckrop_1943 gi|237786494|ref|YP_002907199.1| WP_012732543.1.74818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]