SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|258404823|ref|YP_003197565.1| from Desulfohalobium retbaense DSM 5692

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258404823|ref|YP_003197565.1|
Domain Number 1 Region: 132-276
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000000000000213
Family N-acetyl transferase, NAT 0.034
Further Details:      
 
Weak hits

Sequence:  gi|258404823|ref|YP_003197565.1|
Domain Number - Region: 43-95
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0553
Family N-acetyl transferase, NAT 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|258404823|ref|YP_003197565.1|
Sequence length 278
Comment N-acetyltransferase GCN5 [Desulfohalobium retbaense DSM 5692]
Sequence
MATTDVLEYKGQSRLQHGPLNDRIYLMKLDPGDFPGIVVDLDDLAAEHGYSKIFAKVPER
FRDGFLEQGYLEEGRVPRFYEGQETAVFLGKFLASWRGIATDQHRLQEVLEAAEAKQNGP
VPATQPDLAAVELGVEHAAQAAQLYDTVFDSYPFPIHDPTYIRETMHSHVRYFGVFDGQR
LVALSSSEIDAAARNVEMTDFATLPEYRSKGLAGFLLDHMDTAMREAGLLTAYTIARAVS
FGMNITFARAGYAYGGTLINNTNIAGKLESMNIWYKQL
Download sequence
Identical sequences C8X0P0
485915.Dret_0695 WP_015751145.1.45754 gi|258404823|ref|YP_003197565.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]