SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|258404271|ref|YP_003197013.1| from Desulfohalobium retbaense DSM 5692

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258404271|ref|YP_003197013.1|
Domain Number 1 Region: 185-358
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 7.95e-30
Family FemXAB nonribosomal peptidyltransferases 0.026
Further Details:      
 
Weak hits

Sequence:  gi|258404271|ref|YP_003197013.1|
Domain Number - Region: 17-86
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0494
Family N-acetyl transferase, NAT 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|258404271|ref|YP_003197013.1|
Sequence length 403
Comment hypothetical protein Dret_0133 [Desulfohalobium retbaense DSM 5692]
Sequence
MTAPSTLSLQWHKSMASIPREEWNRLSTPLQNPLLSWDWLHLLETSGAVRTRTGWTPSHV
TLWRERRLVAAAPLYLRHNSWGDYIFDQVWAEVAERIGLGYYPKLVGACPFSPVPGYRFL
LDPAENEQHLTTRILRSIHTMAVKRGISGCHFHFVDPEWKPLLEHCDYLAWVQPGFLWHN
DAFKSFEDFLSRFHRNQRRNIRRELRKPAELGIETRIVPADQAPEQFFTRMYAMYRKTAR
QFGRWGCHFLTPQFFLELSQNKELCRNLLFTAGFERHGSGKPIALSLLIRKGNTLLGRYW
GCLKDYDALHFNLCYYLPIQWAIDHGIAFFDPGMGGEHKSRRGFCAVANHSLHRFFPRPL
MALFRQHIEAINRHQREGIATLNATAPYVFANSQRQWPVEEKN
Download sequence
Identical sequences C8WZG0
WP_015750594.1.45754 485915.Dret_0133 gi|258404271|ref|YP_003197013.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]