SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|225871820|ref|YP_002753274.1| from Acidobacterium capsulatum ATCC 51196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225871820|ref|YP_002753274.1|
Domain Number 1 Region: 1-50
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000195
Family Terminase gpNU1 subunit domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|225871820|ref|YP_002753274.1|
Sequence length 84
Comment MerR family transcriptional regulator [Acidobacterium capsulatum ATCC 51196]
Sequence
MDIRQASDYLGISPDTLYKYASEAFVPAFKLGNRWRFKKSRLDEWMDRQSGIPVEVEVAA
VKPRQKKPVRSTGRTEPRTRIARS
Download sequence
Identical sequences C1F8K0
240015.ACP_0126 gi|225871820|ref|YP_002753274.1| WP_012680532.1.62785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]