SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|225871967|ref|YP_002753421.1| from Acidobacterium capsulatum ATCC 51196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225871967|ref|YP_002753421.1|
Domain Number 1 Region: 154-362,411-546
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.38e-111
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000108
Further Details:      
 
Domain Number 2 Region: 9-147
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.5e-36
Family Anticodon-binding domain 0.0000988
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|225871967|ref|YP_002753421.1|
Sequence length 558
Comment lysine--tRNA ligase [Acidobacterium capsulatum ATCC 51196]
Sequence
MFESDFERNLFTLRQEKLKQIEALGQAAYPNSFAATHTVPEIWARYHDVSGEQLEAERVP
VAIAGRMMANRPAGKAGFAHLQQGGERLQLYVRKDAVGDAAFDVYKLLDLGDHIGVTGYL
FRTRTNELSVHVETLTFLAKAMLAMPDKYHGLEDVELRYRQRYVDLFMNPEVREVFVKRA
KVLAATRKFFDSRGYVEVETPMMQPIAGGAAARPFITHHNALDIDLYLRIAPELYLKRLV
VGGLDRVYEINRNFRNEGISTQHNPEFTMLEFYQAYANYHDLMKLTEEFITFVAQEVNGT
TVTEFPIPKGPRAGEVVEIDLAKWRRFTMREAIIEFWPDEFGAKPTEAEIAFSIDQVLMR
AIRMMHAHFPNWATVFPPETEEQGWAEAEHALKKLTIQIQILLQHVERGLPHGKAISELF
ELLAEEHLIEPTIIYDFPLAVSPLSKQKPDEPEWVERFEFYIGGFELGNAFSELNDPSEQ
QRRFEMQLAERERGDDEAHQMDADYVRALGYGLPPTGGEGIGIDRLTMVLTGSRSIRDVI
LFPLLRPQVREAEKTEEE
Download sequence
Identical sequences C1F9C4
240015.ACP_0278 gi|225871967|ref|YP_002753421.1| WP_012680679.1.62785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]