SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|225872416|ref|YP_002753871.1| from Acidobacterium capsulatum ATCC 51196

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|225872416|ref|YP_002753871.1|
Domain Number - Region: 37-85
Classification Level Classification E-value
Superfamily Acetamidase/Formamidase-like 0.0745
Family Acetamidase/Formamidase-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|225872416|ref|YP_002753871.1|
Sequence length 315
Comment exopolysaccharide biosynthesis/export protein [Acidobacterium capsulatum ATCC 51196]
Sequence
MTKASYLLILLVCFSSCCMAQTQKASTGTAPVALTVQAPPAIQISPGDQISVNVFDIPDL
SVDNARVSQGGTVSLPVAGPIHVAGMTADEAAHYIEHELVVLGLVLHPTVTVSLGQSVGQ
GATIMGQVASPGIYPTFGSRRLLDMLTLAGGVTPSAGKLVTIIHRGDPQHPVHVGLAESS
AGLRSQANPIILPGDTVVVAKAGIIYMVGAVGHPGGYLINNNEHLTLLQALALAGGNAPA
AKLNSAILIRKLPTGTEAIHLNLKKLYEDKQADFLVADGDILYMPSSFVKSALFFQAAEV
GAQLANTAVITSTVF
Download sequence
Identical sequences C1F293
gi|225872416|ref|YP_002753871.1| 240015.ACP_0754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]