SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|225872653|ref|YP_002754110.1| from Acidobacterium capsulatum ATCC 51196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225872653|ref|YP_002754110.1|
Domain Number 1 Region: 2-377
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 3.79e-105
Family Homocysteine S-methyltransferase 0.00000264
Further Details:      
 
Domain Number 2 Region: 327-613
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 2.94e-69
Family Methylenetetrahydrofolate reductase 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|225872653|ref|YP_002754110.1|
Sequence length 636
Comment bifunctional homocysteine S-methyltransferase/5,10-methylenetetrahydrofolate reductase [Acidobacterium capsulatum ATCC 51196]
Sequence
MNNRLKEIFGDRPVLCDGAMGTSLYARGIFINRCFDELNLSQPELVRSVHEDYLQAGAEI
IETNTFGANAIRLRRYGLQDKVAEINQAGARIARAAVAQLADKQAGNAWVAGSVGPLGVR
LEPLGKVGLDEAQAIFAEQIEGLVAGGVDLLVIETMPALNEAQQAIRAARAVAPELPVIA
MVTVDEESRCLDGTAPEVAAARLAGWGADAVGVNCSTGPAAVLTAIECMAEATDLPLAAM
PNAGMPRAVDGRNIYLCSPEYMASFARKFHKSGVQFLGGCCGTTPNHIRAMKSFLRASEA
QKAAVQHSRSAPIVTETPPAPIEQRSRLGQMIHDRTFVTMVEIVPPRGIDCQKEIDGATM
LAGLGVHVINVPDSPRASARMSAQSLCIQLQQKSGIETLLHYTCRDRNVLSIQSDLLGAS
SIGLRNILCLTGDPPKLGNYPDATAVFDVDAIGLVNIVRRLNHGLDIGGNPIGASTGFTI
GCAANPGVPDIDNEVRRFAYKVEAGAEYAITQPVFDLRILESFLKRIEGFRIPVIAGIWP
LTSLRNAEFMRNDLRVSVPDSILLRMQQAATPELARAEGIRIAQEMLETARPMVEGVQVS
APFGRYTAAAEVLAGILPGTSKSDKAQPASEGMQIG
Download sequence
Identical sequences C1F3L2
WP_015896163.1.62785 240015.ACP_1004 gi|225872653|ref|YP_002754110.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]