SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|225872740|ref|YP_002754197.1| from Acidobacterium capsulatum ATCC 51196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225872740|ref|YP_002754197.1|
Domain Number 1 Region: 169-586
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.73e-92
Family beta-Lactamase/D-ala carboxypeptidase 0.00011
Further Details:      
 
Domain Number 2 Region: 45-215
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 6.41e-36
Family Penicillin binding protein dimerisation domain 0.0054
Further Details:      
 
Domain Number 3 Region: 692-746
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000017
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|225872740|ref|YP_002754197.1|
Sequence length 748
Comment penicillin-binding protein [Acidobacterium capsulatum ATCC 51196]
Sequence
MRRIRIVVALALFAAWAAIIGARLFWLQVVDHHKFVQEAKGEQERTFEVAPRRGILYDRD
LHPLAVSVYAESAYAVPYDVTDKAADADLLAKIVHTNPDDRYTTAKAIQARMNASRDFAW
VARRLDPSVYQRVKALHLKGVYFVREFKRYYPDQALAAQVLGYVGSDEQGLGGLEYEFNK
ELRGVPGRMLTALDARRHVLGSQERDPKPGENLVLTIDANIQYMAEKALDENMERTHAEH
GTIVVQDPHTGQILALANRPTFNPNNYRFDNPAQLEDWAVSDVYEPGSTFKLVVYSAALQ
QNIITPESMIPTLGGHINVSGRIVHDDNDAIRYEAQRGNVLTASQALWQSSDVAAIELAE
RMGKDSFYNYIRAFGFGQRTGISLPGETRGLLKPPSRWQPTTIGSIPMGQEIGVTPLQLV
TMASTVANGGVYLPPHIVLEQTQQTPKTGLAAAAFHPGDNLPDPLPPGAHRVISEMASAE
MRKMMEGVVLYGTGIPAQLDGYSAAGKTGTAEKIDPRTHTYSKTKFVASFVGYAPVNDPA
VTIAVVMDSPEHKYHFGTLASAPVFRQLAQEVLEYLGVPHDQPLKTKKQIAQEIKSAPVE
EPQQQLGDMNSLFNEVNHLPPDDPLRQQNPPGSAPVDGQSNPPDVPVSSDSDGSMHPAPP
FASETPAAAQQPPPSAQPAGAPGSITVNARDKVIVPSFLGKSVREVIEQAGAAGLGVQVL
GSGLAHQQVPAAGTRVPEGTQIVVSFQP
Download sequence
Identical sequences C1F464
240015.ACP_1092 WP_015896250.1.62785 gi|225872740|ref|YP_002754197.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]