SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|225872967|ref|YP_002754426.1| from Acidobacterium capsulatum ATCC 51196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225872967|ref|YP_002754426.1|
Domain Number 1 Region: 37-306
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 9.02e-75
Family Proline dehydrohenase domain of bifunctional PutA protein 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|225872967|ref|YP_002754426.1|
Sequence length 308
Comment proline dehydrogenase [Acidobacterium capsulatum ATCC 51196]
Sequence
MPILRSAFIALSRNAALRSFSERSSLGRRMSSRFVAGMQIEEVLRAAEELNRQGIAVTLD
SLGESVTRADEARRSADIYHRLIDAIQERKLNANVSVKLSQMGLELDPSLAHEIAAELVQ
HAAQAGTFVRIDMEGSEFTQTTIDMVRELHARPGHAGHVGIVIQAYLFRSAQDIAQLTQD
GIRIRLCKGAYKEPASIAFPEKSDVDQNYVKLMKMLLTSGIFHGIATHDEAMIAATKQFV
AEQGLDPRSFEFQMLYGIRRDLQTALVREGYGMRVYVPFGTEWYPYFMRRLAERPANVLF
LARNFFRK
Download sequence
Identical sequences C1F5G1
240015.ACP_1336 WP_015896474.1.62785 gi|225872967|ref|YP_002754426.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]