SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|225872994|ref|YP_002754453.1| from Acidobacterium capsulatum ATCC 51196

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|225872994|ref|YP_002754453.1|
Domain Number - Region: 74-122
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0114
Family Terminase gpNU1 subunit domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|225872994|ref|YP_002754453.1|
Sequence length 152
Comment excisionase family DNA binding domain [Acidobacterium capsulatum ATCC 51196]
Sequence
MGTQAIRIAPQNEEETQAVKKLYRMLIHDGAAALVGPDNTRIDLPPTVYQVLRRIIEDMQ
QGKAVALMPVMEELSTQAAADMLGVSRQYLVNELESGKLKFHRAGTHRRIFFKDLCDYKE
ARERNRHDAIQRIAQKSEESGIYDTFVPVDES
Download sequence
Identical sequences C1F5I8
WP_015896501.1.62785 gi|225872994|ref|YP_002754453.1| 240015.ACP_1363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]