SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|225873443|ref|YP_002754902.1| from Acidobacterium capsulatum ATCC 51196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225873443|ref|YP_002754902.1|
Domain Number 1 Region: 111-370
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 8.8e-71
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000774
Further Details:      
 
Domain Number 2 Region: 37-118
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.00000000507
Family Phenylalanyl-tRNA synthetase (PheRS) 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|225873443|ref|YP_002754902.1|
Sequence length 371
Comment phenylalanyl-tRNA synthetase subunit alpha [Acidobacterium capsulatum ATCC 51196]
Sequence
MTMSDQPIPSLTGWTEAELDAAFAALMREVESSAAALDATSAEAVEAFRLHWLGRKQGRL
KAVSDAWLKAAPVEAKKLLGQRFNALKAQVEARLDDASSASSASALDAEAIDITLPGRAR
RLGAEHPLIKTLNEIVSIFQRMGYSVGVGPEVETDYYNFESLNFPPNHPARDTQDTLVVA
QQERKPLRDRLLMRTHTSPVQIRTMEQQPPPVRIVIPGKVHRNDAADATHSPIFHQVEGL
CVDTNITFSDLKGTLDHAMKELFGTSVKTRFFPSFFPFTEPSADVQISCPFCGGKGCRKC
KHSGWIELLGCGMVDPAVFGFVQQKQPGYDPKKISGFAFGMGVDRIAMMKYGISDIGLLY
GGDQRFLEQFG
Download sequence
Identical sequences C1F7U6
240015.ACP_1828 gi|225873443|ref|YP_002754902.1| WP_015896948.1.62785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]