SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|225873528|ref|YP_002754987.1| from Acidobacterium capsulatum ATCC 51196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225873528|ref|YP_002754987.1|
Domain Number 1 Region: 137-271
Classification Level Classification E-value
Superfamily TPR-like 8.47e-30
Family Tetratricopeptide repeat (TPR) 0.0016
Further Details:      
 
Domain Number 2 Region: 9-74
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000169
Family DNA-binding N-terminal domain of transcription activators 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|225873528|ref|YP_002754987.1|
Sequence length 300
Comment hypothetical protein ACP_1920 [Acidobacterium capsulatum ATCC 51196]
Sequence
MSEVIVNSYTRRDILRILRIHAQQLRAWERAGIFPHIETYSFEHLVQLRKLRDLCSTRLS
ASHIRASIQAMQQASGMSNPLLEAGTARDGARVVFRHSGTLMDPIGGQLLFDFEHGADVA
REDGHRFRREPAPHTPAAFLEAVQCEEAGNIDEAVALYEAILAQAPGHAPSAINLGTIYY
HRKDYARAERLYRGATEADPNYALAFFDLGNVLDELQRMTEAIEAYQAAIRLVPRYADAH
YNLALAYERQGERRQALRHWTAYIKLDPHGPWHNHARLQIRKLLDREKLKIVARRSSSSK
Download sequence
Identical sequences C1F8B1
240015.ACP_1920 WP_015897033.1.62785 gi|225873528|ref|YP_002754987.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]