SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|225873756|ref|YP_002755215.1| from Acidobacterium capsulatum ATCC 51196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225873756|ref|YP_002755215.1|
Domain Number 1 Region: 279-568
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.21e-96
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000957
Further Details:      
 
Domain Number 2 Region: 99-277
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 2.62e-58
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0000135
Further Details:      
 
Domain Number 3 Region: 571-676
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.66e-32
Family Anticodon-binding domain of Class II aaRS 0.00013
Further Details:      
 
Domain Number 4 Region: 5-45
Classification Level Classification E-value
Superfamily TGS-like 0.0000000133
Family TGS domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|225873756|ref|YP_002755215.1|
Sequence length 681
Comment threonyl-tRNA synthetase [Acidobacterium capsulatum ATCC 51196]
Sequence
MEKQIQVTLPDGTVKTFPAGTTPFQVAESISPRLAQAAVVARIQTTQPAAATVTAGSEAD
SKTASEAAMYSAADPGAPRLVDLSTPLEEDVQLALLTEKDPEALKVLRHSAAHLMATAVL
ELFPETKLGHGPATDAGFFYDFYRPTPFTPEDLKLIEGRMAEIAQRNDKFVREFIPREEG
LAEFKAGDDFMKVHFIERFTQPGEAISLYRNGNFVDFCRGPHVPSTNRIKAFKVTNLAGA
YWLGDEKNPQLQRLYGTAFFSKKDLDEHFARLEEIAKRDHRVLGKQLDLFSIQEIAGAGL
IFWHPKGAMIRKIMEDWMREECIRRGYDLVYTPHVMRVQLWKTSGHEGFYSQNMFTPMEL
DDAEYRLKPMNCPGHILIYKSQPRSYRDLPVRYAELGNVYRYERSGTMHGLLRVRGFTQD
DAHIFCTPEQIEDEVVACIDFAQSVLTTFGFMDFQVELSTWDPNDRKNYAGSDDKWNLAI
SSLESALTRKGIAYKTIAGEAAFYGPKIDIKLVDVLGRLWQLSTVQFDFNLPARFELEYV
GEDGERHQPVMVHRALYGSVERFFGVLIEHYAGAFPLWLAPVQIGLVPISERHLAYAEKV
QQQLEAAGFRVELDRRNEKMNAKIRDFTLQKFPYVLIMGDKEAEAGAVSVRTRGKGDQGS
LPLDEFIGRATTLIDTKSGDL
Download sequence
Identical sequences C1F9K5
WP_015897261.1.62785 240015.ACP_2162 gi|225873756|ref|YP_002755215.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]