SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|225873796|ref|YP_002755255.1| from Acidobacterium capsulatum ATCC 51196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225873796|ref|YP_002755255.1|
Domain Number 1 Region: 127-446
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.39e-90
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000213
Further Details:      
 
Domain Number 2 Region: 20-111
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.07e-21
Family Anticodon-binding domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|225873796|ref|YP_002755255.1|
Sequence length 452
Comment asparaginyl-tRNA synthetase [Acidobacterium capsulatum ATCC 51196]
Sequence
MTEETNVTNTATEAPLTTIARIGEHEGKTITLRGWLYNLRESGKLLFPIFRDGSGTIQGI
VPKAAVAPEVFERIKGLTQESSVIVTGKVRADHRAPGGYELDVENVEVVQRVPEDTPFPI
SLKEHGTDFLMEHRHLWIRTPRQSAILRIRAEIIKAARDFLDDNGFILTDPPILTPAACE
GTSTLFPVEYFGDEAYLTQSGQLYIESTALALGKVYSFGPTFRAEKSKTRRHLTEFWMVE
PEWAYAGLDDLMGLAEQFISFIVGRVLTRRAADLKVLGRDVAKLQSIQAPFPRLSYDEAA
QMLNDAHAKGLLEHPFEYGNDFGSPDETYISSQFDRPVMVHRYPAAVKAFYMEPDPENSK
YALCVDVLAPEGYGEIIGGSQRISSYELLKQRIEDHQLPLEAFQWYLDLRRYGSVPHSGF
GMGIERAVAWICGLEHVRETIPFARTLNRIYP
Download sequence
Identical sequences C1F9P5
gi|225873796|ref|YP_002755255.1| 240015.ACP_2204 WP_015897301.1.62785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]