SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|225873931|ref|YP_002755390.1| from Acidobacterium capsulatum ATCC 51196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225873931|ref|YP_002755390.1|
Domain Number 1 Region: 121-302,446-608
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.93e-103
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000537
Further Details:      
 
Domain Number 2 Region: 10-114
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.64e-32
Family Anticodon-binding domain 0.0000936
Further Details:      
 
Weak hits

Sequence:  gi|225873931|ref|YP_002755390.1|
Domain Number - Region: 302-429
Classification Level Classification E-value
Superfamily GAD domain-like 0.0154
Family GAD domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|225873931|ref|YP_002755390.1|
Sequence length 610
Comment aspartate--tRNA ligase [Acidobacterium capsulatum ATCC 51196]
Sequence
MLDFLGTKQRTHTCGELRAAHAGETITIMGWVNRRRDHGNLIFLDLRDRYGITQVVLDKD
LSAEAHAKAEQARPEYVICATGKVRARSQEAINPKMPTGEIEIAATELLILNDSKVPPFS
PAEEAIANEEVRLKYRYLDLRRPEMQHNFEVRHKVALAVRQYLSGQGFFEVETPFMTRST
PEGARDYLVPSRVHPGEFYALPQSPQLFKQILMISGMDRYFQIARCFRDEDLRADRQPEF
TQIDLEMTFPQQETIFGVVEGFLAAAFEAVGQQITVPFPRMTYDKAIELYGIDKPDLRLP
PMTDVRSVFSDEELQSLKIEPGMPIVAIVIPNKSAMSNTQKKAFGKEVEEQVGAELAYLD
VERLRTSPQFALLADRIDAAAAAHCKLERVEPDHRLVVISPRLGAAAVSRDTSWVYKRAG
QLRLELGKRFAAEHKAFEKKGTAADYQFLWVTDFPFFEWDEQSHTWTFAHHPFTSPHQDD
LIAGRLESDQAAVRALAYDVVLNGTELGSGSIRIHRQDVQQQIFRALGMSDDEAKERFGF
FLEALQYGTPPHGGIALGLDRIVMILAGASSLREVIAFPKTAKAIDLMVDAPTPVSDAQL
RELHIRPTKQ
Download sequence
Identical sequences C1FAE8
gi|225873931|ref|YP_002755390.1| 240015.ACP_2346 WP_015897436.1.62785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]