SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|225873933|ref|YP_002755392.1| from Acidobacterium capsulatum ATCC 51196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225873933|ref|YP_002755392.1|
Domain Number 1 Region: 5-327
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.19e-90
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000426
Further Details:      
 
Domain Number 2 Region: 339-425
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 6.71e-16
Family Anticodon-binding domain of Class II aaRS 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|225873933|ref|YP_002755392.1|
Sequence length 427
Comment histidyl-tRNA synthetase [Acidobacterium capsulatum ATCC 51196]
Sequence
MSTLKAVRGTRDLLPPETELWNKVEATARRVFARYNFGEIRTPLFEDTSLFARGVGEETD
IVSKEMYTWEDRARAQSEKPQSLTLRPENTAGVVRAYIEHKLGETGMLQKLYYIGPQFRR
ERPQKGRYRQFWQIGAEVIGPASAGSESPLRDAEVLEMLAAFLHELGIRDAKLSINSVGS
ASDRPRYVAALREALQDKAPQMCVDCQRRAETNPLRVLDCKVPEDQPIIDALPKIADYLD
EESKAHFAAVCAALDACGVAYEVNPRLVRGLDYYTRTTFEFSHGGLGAQNALLGGGRYDG
LSEAIGGPKAPGIGFAMGEDRLILTLQAQASEAASTLADAYVAPLGEGMNAAALRLAHEL
RGAGLKIELGDGSFRLKKSFEMGNKLARKIILFGEDELASGMLTVKDFASGEQVKVARGE
IAHFLGA
Download sequence
Identical sequences C1FAF0
gi|225873933|ref|YP_002755392.1| WP_015897438.1.62785 240015.ACP_2348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]