SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|225874145|ref|YP_002755604.1| from Acidobacterium capsulatum ATCC 51196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225874145|ref|YP_002755604.1|
Domain Number 1 Region: 16-197
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.72e-51
Family Biotin holoenzyme synthetase 0.00034
Further Details:      
 
Weak hits

Sequence:  gi|225874145|ref|YP_002755604.1|
Domain Number - Region: 225-265
Classification Level Classification E-value
Superfamily C-terminal domain of transcriptional repressors 0.00156
Family Biotin repressor (BirA) 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|225874145|ref|YP_002755604.1|
Sequence length 272
Comment biotin--acetyl-CoA-carboxylase ligase [Acidobacterium capsulatum ATCC 51196]
Sequence
MEAAVQALDLNAMNAALAETPFAGRITLFPAITSTNTHAMAEGDAGAAHGSVYVAEEQTG
GRGRGAHAWASPPGSGLYVSVLLRPQMAPGDALWISLAAGLAVRHAVEEMTTLQADLRWP
NDLMLGKKKFCGILTEMHAEATRVRHVVVGIGINVLQMAFPEGLDAMATSLQIETGLQWS
RQDLLVALLQALDREMSALGDAMRMDAAKQSILERIERASSWVRGKRVRVDEGAGFAGVT
DGLNAQGFLQVRTQDGIRTVLSGGVREDDGGR
Download sequence
Identical sequences C1F228
WP_015897649.1.62785 gi|225874145|ref|YP_002755604.1| 240015.ACP_2581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]